Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179IFQ1

Protein Details
Accession A0A179IFQ1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
152-172SLPNIMKAKKKKLDKMKLADLHydrophilic
NLS Segment(s)
PositionSequence
160-163KKKK
Subcellular Location(s) mito 13, cyto 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014730  ETF_a/b_N  
IPR012255  ETF_b  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0009055  F:electron transfer activity  
Pfam View protein in Pfam  
PF01012  ETF  
Amino Acid Sequences MSSLRILVPIKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEESVRIREKKRSPGGVEDICVVSAGPAKAQDVLRTAMAMGADRGIHVEVPEGEELAPLTVAKLLAKTAEQQRSNLVEVDGGVETVRARLPMVITTDLRLNEPRYASLPNIMKAKKKKLDKMKLADLGIGNDVRLKILKVTEPPARQGGGKVEDVDGLIGKLKELGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.43
5 0.45
6 0.44
7 0.49
8 0.56
9 0.5
10 0.48
11 0.44
12 0.43
13 0.41
14 0.46
15 0.42
16 0.35
17 0.34
18 0.31
19 0.3
20 0.22
21 0.2
22 0.18
23 0.21
24 0.21
25 0.22
26 0.25
27 0.22
28 0.21
29 0.22
30 0.19
31 0.18
32 0.16
33 0.15
34 0.13
35 0.13
36 0.15
37 0.2
38 0.22
39 0.22
40 0.3
41 0.36
42 0.45
43 0.53
44 0.58
45 0.55
46 0.59
47 0.64
48 0.56
49 0.5
50 0.42
51 0.34
52 0.26
53 0.23
54 0.16
55 0.08
56 0.1
57 0.09
58 0.07
59 0.08
60 0.08
61 0.12
62 0.12
63 0.13
64 0.12
65 0.14
66 0.13
67 0.13
68 0.12
69 0.1
70 0.09
71 0.08
72 0.06
73 0.05
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.05
89 0.05
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.09
100 0.15
101 0.22
102 0.23
103 0.24
104 0.27
105 0.29
106 0.29
107 0.26
108 0.19
109 0.12
110 0.11
111 0.12
112 0.09
113 0.07
114 0.06
115 0.05
116 0.05
117 0.06
118 0.06
119 0.05
120 0.05
121 0.06
122 0.06
123 0.08
124 0.11
125 0.13
126 0.13
127 0.14
128 0.17
129 0.17
130 0.18
131 0.18
132 0.18
133 0.18
134 0.19
135 0.19
136 0.18
137 0.2
138 0.19
139 0.23
140 0.24
141 0.24
142 0.31
143 0.32
144 0.38
145 0.43
146 0.52
147 0.54
148 0.59
149 0.65
150 0.69
151 0.78
152 0.8
153 0.81
154 0.8
155 0.77
156 0.69
157 0.63
158 0.52
159 0.43
160 0.36
161 0.28
162 0.19
163 0.15
164 0.15
165 0.12
166 0.12
167 0.12
168 0.11
169 0.14
170 0.18
171 0.2
172 0.27
173 0.34
174 0.35
175 0.39
176 0.39
177 0.38
178 0.35
179 0.33
180 0.34
181 0.3
182 0.3
183 0.27
184 0.25
185 0.24
186 0.23
187 0.21
188 0.15
189 0.11
190 0.13
191 0.11
192 0.11
193 0.11