Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8P3W7

Protein Details
Accession A8P3W7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
23-48LVLATYKRVRNRSRLPKPPGPKGYPIHydrophilic
NLS Segment(s)
PositionSequence
36-36R
38-39PK
Subcellular Location(s) plas 6, extr 5, mito 4, E.R. 4, cyto 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG cci:CC1G_07815  -  
Amino Acid Sequences MLQFWRFDLAIALASGVTAATALVLATYKRVRNRSRLPKPPGPKGYPIIGNLFDVPSKRSWIGYKELSEKYGIMDLGGYMTVMPYGTRLNRHRKMFRQHIESNDISKWYPIIRRQVFDCMKAVAAIPDSWNTHFNHLFTSMMVEITYGVKTKSLQDPFIKDMMEAALGFAQAALPGSFLVDTFPILKYVPTWFPGAYFKRFAAYYKAVDYKARNDPKFDHVTRAMKAGTSRPCVVSSMVEALPEENDPTRAEEETIARNVAAMIHAVGYGRMPEFSDKESLVQILHDPETFEDPFAFKPERYIKDGKQLSDSGEDENGKPTIKYGVTDGALSHPEPFEFELQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.05
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.05
12 0.05
13 0.1
14 0.15
15 0.21
16 0.28
17 0.38
18 0.44
19 0.53
20 0.64
21 0.71
22 0.77
23 0.82
24 0.84
25 0.85
26 0.87
27 0.87
28 0.86
29 0.8
30 0.76
31 0.7
32 0.66
33 0.61
34 0.54
35 0.48
36 0.4
37 0.35
38 0.3
39 0.26
40 0.22
41 0.19
42 0.19
43 0.16
44 0.19
45 0.19
46 0.2
47 0.23
48 0.26
49 0.31
50 0.35
51 0.38
52 0.41
53 0.42
54 0.4
55 0.38
56 0.34
57 0.28
58 0.26
59 0.2
60 0.13
61 0.11
62 0.1
63 0.09
64 0.09
65 0.07
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.08
73 0.11
74 0.18
75 0.26
76 0.37
77 0.44
78 0.53
79 0.6
80 0.65
81 0.73
82 0.76
83 0.77
84 0.75
85 0.72
86 0.69
87 0.67
88 0.6
89 0.53
90 0.44
91 0.37
92 0.29
93 0.24
94 0.2
95 0.17
96 0.2
97 0.22
98 0.31
99 0.33
100 0.35
101 0.37
102 0.46
103 0.45
104 0.42
105 0.38
106 0.28
107 0.25
108 0.23
109 0.21
110 0.12
111 0.11
112 0.09
113 0.09
114 0.1
115 0.11
116 0.12
117 0.15
118 0.15
119 0.19
120 0.19
121 0.19
122 0.18
123 0.18
124 0.17
125 0.13
126 0.14
127 0.1
128 0.09
129 0.08
130 0.07
131 0.06
132 0.07
133 0.07
134 0.06
135 0.06
136 0.06
137 0.07
138 0.1
139 0.17
140 0.18
141 0.22
142 0.24
143 0.28
144 0.3
145 0.31
146 0.28
147 0.2
148 0.18
149 0.15
150 0.12
151 0.08
152 0.06
153 0.05
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.1
176 0.11
177 0.11
178 0.13
179 0.12
180 0.13
181 0.2
182 0.23
183 0.23
184 0.23
185 0.22
186 0.22
187 0.23
188 0.23
189 0.22
190 0.22
191 0.21
192 0.23
193 0.26
194 0.25
195 0.28
196 0.29
197 0.28
198 0.35
199 0.42
200 0.39
201 0.39
202 0.41
203 0.45
204 0.51
205 0.46
206 0.42
207 0.39
208 0.43
209 0.4
210 0.4
211 0.33
212 0.26
213 0.27
214 0.28
215 0.27
216 0.28
217 0.29
218 0.27
219 0.28
220 0.28
221 0.27
222 0.22
223 0.17
224 0.17
225 0.15
226 0.14
227 0.13
228 0.12
229 0.12
230 0.11
231 0.11
232 0.07
233 0.09
234 0.09
235 0.12
236 0.13
237 0.13
238 0.13
239 0.14
240 0.17
241 0.19
242 0.2
243 0.18
244 0.16
245 0.15
246 0.14
247 0.13
248 0.1
249 0.07
250 0.05
251 0.05
252 0.06
253 0.06
254 0.06
255 0.06
256 0.07
257 0.07
258 0.07
259 0.08
260 0.11
261 0.13
262 0.15
263 0.18
264 0.17
265 0.18
266 0.19
267 0.19
268 0.16
269 0.14
270 0.14
271 0.14
272 0.15
273 0.14
274 0.14
275 0.15
276 0.19
277 0.19
278 0.17
279 0.15
280 0.15
281 0.16
282 0.2
283 0.21
284 0.16
285 0.24
286 0.33
287 0.37
288 0.42
289 0.48
290 0.47
291 0.55
292 0.6
293 0.54
294 0.5
295 0.47
296 0.43
297 0.42
298 0.39
299 0.31
300 0.31
301 0.31
302 0.26
303 0.28
304 0.27
305 0.22
306 0.21
307 0.19
308 0.21
309 0.2
310 0.2
311 0.2
312 0.24
313 0.25
314 0.25
315 0.25
316 0.23
317 0.24
318 0.23
319 0.22
320 0.17
321 0.16
322 0.18