Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179IIG7

Protein Details
Accession A0A179IIG7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-35SEDRKARLAKLKNLKRKQPTNELVAHydrophilic
NLS Segment(s)
PositionSequence
19-25AKLKNLK
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences MSSHNTLSAASEDRKARLAKLKNLKRKQPTNELVAPEADERLPAPSGNSQGEAGEDDGAPPDVTHLHLSGRNYDPETRGPKLGFEAPPTLGDDKTLLEQQAADLEAQVKQQAAAEAAEEKGIDLFKLQPKKPNWDLKRNLEQKMDVLNVRTDNAIARLVKDRITAAQKAAQKASGGEDVETAGMDGATLVESLRVREQEEEEEERREKAEEEALAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.39
5 0.45
6 0.49
7 0.58
8 0.66
9 0.72
10 0.8
11 0.84
12 0.85
13 0.87
14 0.85
15 0.85
16 0.8
17 0.77
18 0.74
19 0.67
20 0.58
21 0.49
22 0.43
23 0.32
24 0.28
25 0.2
26 0.14
27 0.11
28 0.12
29 0.12
30 0.1
31 0.12
32 0.13
33 0.17
34 0.18
35 0.19
36 0.17
37 0.16
38 0.17
39 0.16
40 0.13
41 0.1
42 0.09
43 0.08
44 0.08
45 0.09
46 0.08
47 0.07
48 0.07
49 0.06
50 0.08
51 0.09
52 0.09
53 0.1
54 0.13
55 0.14
56 0.19
57 0.2
58 0.21
59 0.22
60 0.24
61 0.24
62 0.28
63 0.32
64 0.29
65 0.29
66 0.27
67 0.25
68 0.26
69 0.29
70 0.24
71 0.21
72 0.22
73 0.2
74 0.2
75 0.21
76 0.2
77 0.14
78 0.13
79 0.11
80 0.1
81 0.1
82 0.11
83 0.09
84 0.07
85 0.08
86 0.07
87 0.08
88 0.07
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.07
95 0.06
96 0.05
97 0.06
98 0.06
99 0.06
100 0.05
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.08
112 0.13
113 0.21
114 0.22
115 0.29
116 0.32
117 0.41
118 0.48
119 0.55
120 0.56
121 0.6
122 0.66
123 0.66
124 0.74
125 0.72
126 0.68
127 0.6
128 0.54
129 0.45
130 0.42
131 0.36
132 0.27
133 0.22
134 0.21
135 0.19
136 0.19
137 0.17
138 0.13
139 0.12
140 0.12
141 0.14
142 0.12
143 0.13
144 0.18
145 0.19
146 0.2
147 0.2
148 0.19
149 0.21
150 0.25
151 0.25
152 0.22
153 0.27
154 0.3
155 0.33
156 0.33
157 0.29
158 0.25
159 0.24
160 0.25
161 0.23
162 0.2
163 0.17
164 0.16
165 0.15
166 0.14
167 0.13
168 0.1
169 0.06
170 0.05
171 0.04
172 0.04
173 0.03
174 0.04
175 0.04
176 0.04
177 0.07
178 0.07
179 0.1
180 0.14
181 0.15
182 0.16
183 0.19
184 0.22
185 0.25
186 0.3
187 0.35
188 0.34
189 0.39
190 0.38
191 0.36
192 0.35
193 0.31
194 0.26
195 0.23
196 0.26