Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IKM6

Protein Details
Accession V5IKM6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-222AAEVKKLEKEKREKKKIMKRKIADDAESTELPAKKVREDKKGRKGKKGNTKEMKGTNKABasic
NLS Segment(s)
PositionSequence
149-215KLKREKAKQEEEKRLAAEVKKLEKEKREKKKIMKRKIADDAESTELPAKKVREDKKGRKGKKGNTKE
Subcellular Location(s) nucl 7, mito 6, extr 4, cyto_nucl 4, E.R. 4
Family & Domain DBs
KEGG ncr:NCU12086  -  
Amino Acid Sequences MVPNTPRSIKHHQQQILCITTSASFLVTVLAGIYPSKTHSPDRSIQAQQRNTMCGNYYQHHAPCGHGGIVSVNSCRALGSTCFGPDPSKGMDITLPPINSRCSDCHAAAHQPNPDARLDENDPYRKEARERAAALETEARIFRAEQEEKLKREKAKQEEEKRLAAEVKKLEKEKREKKKIMKRKIADDAESTELPAKKVREDKKGRKGKKGNTKEMKGTNKAEAEEDNANRNDNKNDDGNDNGDDGYTSDIYNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.61
4 0.53
5 0.44
6 0.36
7 0.3
8 0.26
9 0.2
10 0.13
11 0.09
12 0.08
13 0.09
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.09
23 0.13
24 0.16
25 0.22
26 0.27
27 0.33
28 0.39
29 0.44
30 0.48
31 0.52
32 0.57
33 0.6
34 0.59
35 0.6
36 0.55
37 0.53
38 0.47
39 0.41
40 0.34
41 0.3
42 0.31
43 0.26
44 0.28
45 0.29
46 0.29
47 0.31
48 0.3
49 0.26
50 0.24
51 0.24
52 0.2
53 0.15
54 0.15
55 0.13
56 0.14
57 0.14
58 0.12
59 0.1
60 0.1
61 0.1
62 0.09
63 0.08
64 0.08
65 0.08
66 0.1
67 0.11
68 0.11
69 0.12
70 0.12
71 0.13
72 0.12
73 0.14
74 0.13
75 0.13
76 0.12
77 0.13
78 0.13
79 0.13
80 0.16
81 0.16
82 0.14
83 0.14
84 0.15
85 0.16
86 0.16
87 0.18
88 0.16
89 0.18
90 0.21
91 0.21
92 0.22
93 0.23
94 0.28
95 0.28
96 0.29
97 0.26
98 0.25
99 0.25
100 0.24
101 0.22
102 0.17
103 0.15
104 0.16
105 0.16
106 0.18
107 0.22
108 0.25
109 0.26
110 0.28
111 0.29
112 0.26
113 0.26
114 0.29
115 0.28
116 0.3
117 0.3
118 0.29
119 0.29
120 0.28
121 0.26
122 0.23
123 0.18
124 0.14
125 0.13
126 0.1
127 0.09
128 0.09
129 0.1
130 0.14
131 0.15
132 0.17
133 0.26
134 0.31
135 0.33
136 0.38
137 0.42
138 0.38
139 0.45
140 0.5
141 0.5
142 0.55
143 0.63
144 0.67
145 0.73
146 0.73
147 0.68
148 0.6
149 0.53
150 0.47
151 0.38
152 0.34
153 0.29
154 0.31
155 0.33
156 0.37
157 0.4
158 0.45
159 0.54
160 0.6
161 0.65
162 0.7
163 0.74
164 0.8
165 0.87
166 0.89
167 0.89
168 0.89
169 0.84
170 0.81
171 0.83
172 0.77
173 0.68
174 0.6
175 0.53
176 0.47
177 0.41
178 0.33
179 0.28
180 0.25
181 0.23
182 0.25
183 0.22
184 0.24
185 0.33
186 0.39
187 0.44
188 0.54
189 0.64
190 0.7
191 0.8
192 0.81
193 0.83
194 0.86
195 0.86
196 0.86
197 0.86
198 0.86
199 0.86
200 0.85
201 0.82
202 0.82
203 0.8
204 0.76
205 0.69
206 0.65
207 0.57
208 0.52
209 0.46
210 0.38
211 0.34
212 0.34
213 0.32
214 0.32
215 0.3
216 0.32
217 0.32
218 0.34
219 0.34
220 0.3
221 0.32
222 0.31
223 0.33
224 0.34
225 0.35
226 0.34
227 0.31
228 0.29
229 0.25
230 0.19
231 0.17
232 0.14
233 0.14
234 0.12