Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179IA42

Protein Details
Accession A0A179IA42    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-101SSSNPRGKANKRPKNCRLRNRVYFYSRHydrophilic
NLS Segment(s)
PositionSequence
82-86KANKR
Subcellular Location(s) mito 21.5, mito_nucl 14, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MAKKAKTRLIHVRLLSMAMTGFFYTFKRPRTALPMGLMKYDPIGMRKTRPTSEAVTTLEQTPANLSCSQCAKRSSSSNPRGKANKRPKNCRLRNRVYFYSRTPFFRLPATQTATRMTSKLATRYRSRRDDSVALYYNTRIPGVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.37
3 0.26
4 0.2
5 0.12
6 0.12
7 0.09
8 0.08
9 0.08
10 0.09
11 0.16
12 0.21
13 0.24
14 0.27
15 0.28
16 0.32
17 0.39
18 0.43
19 0.39
20 0.39
21 0.42
22 0.39
23 0.39
24 0.36
25 0.28
26 0.23
27 0.21
28 0.17
29 0.13
30 0.16
31 0.17
32 0.21
33 0.28
34 0.32
35 0.32
36 0.32
37 0.34
38 0.33
39 0.34
40 0.33
41 0.29
42 0.26
43 0.26
44 0.24
45 0.22
46 0.18
47 0.15
48 0.13
49 0.11
50 0.12
51 0.12
52 0.12
53 0.12
54 0.17
55 0.18
56 0.21
57 0.22
58 0.22
59 0.24
60 0.28
61 0.34
62 0.4
63 0.48
64 0.52
65 0.52
66 0.56
67 0.61
68 0.61
69 0.64
70 0.65
71 0.64
72 0.67
73 0.74
74 0.78
75 0.81
76 0.86
77 0.86
78 0.85
79 0.86
80 0.86
81 0.84
82 0.82
83 0.76
84 0.7
85 0.64
86 0.62
87 0.55
88 0.49
89 0.47
90 0.41
91 0.37
92 0.38
93 0.36
94 0.33
95 0.36
96 0.38
97 0.34
98 0.34
99 0.36
100 0.34
101 0.33
102 0.28
103 0.23
104 0.23
105 0.24
106 0.32
107 0.35
108 0.38
109 0.46
110 0.55
111 0.63
112 0.67
113 0.69
114 0.65
115 0.66
116 0.67
117 0.62
118 0.61
119 0.56
120 0.49
121 0.45
122 0.41
123 0.38
124 0.33
125 0.29