Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179IVQ2

Protein Details
Accession A0A179IVQ2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-96TGVAPVIDRKKKKKKQQGSAAGNGMHydrophilic
NLS Segment(s)
PositionSequence
80-86RKKKKKK
Subcellular Location(s) cyto 13.5, cyto_nucl 13, nucl 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001202  WW_dom  
IPR036020  WW_dom_sf  
PROSITE View protein in PROSITE  
PS01159  WW_DOMAIN_1  
Amino Acid Sequences MPAGLASGLPAGWEWDYDGTRWFYTFKANGHTQYHFPSEGDEFPDFVDVSEPAPDLEPEERLESHQQVKRVTGVAPVIDRKKKKKKQQGSAAGNGMTATARPVGIEWDGDVGEDSSGEEDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.12
4 0.13
5 0.16
6 0.17
7 0.18
8 0.18
9 0.18
10 0.15
11 0.21
12 0.24
13 0.23
14 0.26
15 0.29
16 0.33
17 0.37
18 0.38
19 0.34
20 0.34
21 0.35
22 0.29
23 0.26
24 0.22
25 0.21
26 0.19
27 0.21
28 0.18
29 0.15
30 0.14
31 0.15
32 0.13
33 0.11
34 0.1
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.07
41 0.06
42 0.07
43 0.08
44 0.08
45 0.08
46 0.1
47 0.1
48 0.11
49 0.14
50 0.14
51 0.21
52 0.22
53 0.24
54 0.24
55 0.24
56 0.24
57 0.23
58 0.21
59 0.16
60 0.15
61 0.13
62 0.14
63 0.18
64 0.23
65 0.28
66 0.34
67 0.41
68 0.52
69 0.6
70 0.69
71 0.76
72 0.8
73 0.84
74 0.9
75 0.91
76 0.87
77 0.84
78 0.77
79 0.66
80 0.55
81 0.44
82 0.33
83 0.22
84 0.15
85 0.09
86 0.07
87 0.06
88 0.06
89 0.07
90 0.09
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.09
99 0.08
100 0.08
101 0.08