Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5INH2

Protein Details
Accession V5INH2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
116-143EAVVCKNCERKLRKMEKKKKDKGKEKDKBasic
NLS Segment(s)
PositionSequence
125-143RKLRKMEKKKKDKGKEKDK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG ncr:NCU16554  -  
Amino Acid Sequences MDLDQHIHHPSLRRNPRVASDLEYLSNNSRKPIYSPCAFTSTASYVSETTTTTTTTLQHTNQLQTKMCTKHFVDSYCTSCDELVQGRSTESPCKPKYRGEHLGHCAAGIESKTVTEAVVCKNCERKLRKMEKKKKDKGKEKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.61
4 0.59
5 0.53
6 0.47
7 0.42
8 0.37
9 0.34
10 0.32
11 0.28
12 0.29
13 0.31
14 0.26
15 0.24
16 0.23
17 0.23
18 0.25
19 0.31
20 0.32
21 0.32
22 0.36
23 0.37
24 0.39
25 0.39
26 0.36
27 0.32
28 0.28
29 0.26
30 0.22
31 0.2
32 0.16
33 0.16
34 0.16
35 0.12
36 0.11
37 0.1
38 0.1
39 0.09
40 0.1
41 0.11
42 0.13
43 0.15
44 0.14
45 0.19
46 0.2
47 0.23
48 0.26
49 0.28
50 0.26
51 0.25
52 0.31
53 0.29
54 0.28
55 0.28
56 0.25
57 0.27
58 0.28
59 0.28
60 0.27
61 0.27
62 0.29
63 0.26
64 0.26
65 0.22
66 0.19
67 0.17
68 0.14
69 0.13
70 0.12
71 0.11
72 0.11
73 0.11
74 0.13
75 0.14
76 0.18
77 0.2
78 0.27
79 0.29
80 0.35
81 0.37
82 0.42
83 0.49
84 0.53
85 0.59
86 0.57
87 0.62
88 0.6
89 0.62
90 0.55
91 0.47
92 0.38
93 0.28
94 0.24
95 0.15
96 0.12
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.1
104 0.15
105 0.21
106 0.23
107 0.26
108 0.33
109 0.38
110 0.46
111 0.5
112 0.53
113 0.58
114 0.68
115 0.76
116 0.8
117 0.86
118 0.88
119 0.94
120 0.94
121 0.94
122 0.94
123 0.94