Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IKQ7

Protein Details
Accession V5IKQ7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-93MVESRPSRRRPGRASSRRCHATRHydrophilic
NLS Segment(s)
PositionSequence
76-88PSRRRPGRASSRR
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
KEGG ncr:NCU17275  -  
Amino Acid Sequences MQTACRQPLFPVGLLPSSTCLEAQMIRKKESDQQRAAGFLFLGHPSMPSSRKQWQPSIRANTTKRRGMDTMVESRPSRRRPGRASSRRCHATRRQKLELETK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.19
4 0.16
5 0.16
6 0.14
7 0.12
8 0.12
9 0.15
10 0.22
11 0.28
12 0.3
13 0.32
14 0.33
15 0.34
16 0.41
17 0.48
18 0.49
19 0.44
20 0.44
21 0.43
22 0.44
23 0.42
24 0.35
25 0.24
26 0.15
27 0.13
28 0.09
29 0.09
30 0.07
31 0.07
32 0.07
33 0.1
34 0.11
35 0.12
36 0.16
37 0.22
38 0.29
39 0.32
40 0.39
41 0.44
42 0.5
43 0.56
44 0.6
45 0.58
46 0.59
47 0.6
48 0.62
49 0.62
50 0.59
51 0.52
52 0.48
53 0.45
54 0.4
55 0.42
56 0.37
57 0.38
58 0.35
59 0.38
60 0.34
61 0.38
62 0.44
63 0.42
64 0.46
65 0.46
66 0.53
67 0.56
68 0.67
69 0.73
70 0.75
71 0.81
72 0.79
73 0.81
74 0.81
75 0.76
76 0.74
77 0.73
78 0.74
79 0.75
80 0.77
81 0.75
82 0.72