Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179I430

Protein Details
Accession A0A179I430   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-67LCHILPAGLRRRRRRLHLVPLLLHydrophilic
NLS Segment(s)
PositionSequence
54-61RRRRRRLH
71-83ARAPHAPVRKGRA
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027539  Mdm10  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0000002  P:mitochondrial genome maintenance  
GO:0070096  P:mitochondrial outer membrane translocase complex assembly  
GO:1990456  P:mitochondrion-endoplasmic reticulum membrane tethering  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
Pfam View protein in Pfam  
PF12519  MDM10  
Amino Acid Sequences MREFMDYVHSAFYEATGWSRDNSSPELSHAARLAPHPLRPREPQLCHILPAGLRRRRRRLHLVPLLLGAAARAPHAPVRKGRAARAAALLPTPHTADGHRADAAPVPAGEQQPGRDPAASIVVLRKTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQASLFYGRLYLPQSQLEALVVKRLSQHLQVQFSAVSSQHLRNGGTTLGLAQYDVGKYAVEGLASSDGGLLGLRGIYNFGGDAEQQPQTPGEQNPAGVTSKSTTTTTSSPPSDKERIYGRFSTGAEIYYGTLNKSGGISLATRFATLPSHKGTPLAATLTLNPLMGSIGASYSVVAGQHCSLATRMEFNAFSYESAWAVGMELWRKPFARPLSSSDEIAISPLRPRERSFRAKMEWRLDDSPEKLLADLAEVKSEAESSSSSSTSAADVQAPSQEAEAAAGKKINNIELPRQPECREVKEEEYAGVLKARLDQNLRIGLLWEGRVKSLLFSLGSGIDLRHTDKPFRTLGLEIQFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.15
6 0.18
7 0.2
8 0.22
9 0.26
10 0.28
11 0.26
12 0.28
13 0.33
14 0.31
15 0.31
16 0.29
17 0.27
18 0.24
19 0.25
20 0.31
21 0.28
22 0.34
23 0.4
24 0.46
25 0.5
26 0.55
27 0.63
28 0.64
29 0.65
30 0.65
31 0.65
32 0.61
33 0.56
34 0.51
35 0.44
36 0.36
37 0.4
38 0.44
39 0.42
40 0.5
41 0.57
42 0.66
43 0.71
44 0.78
45 0.8
46 0.8
47 0.83
48 0.84
49 0.8
50 0.71
51 0.64
52 0.56
53 0.45
54 0.34
55 0.23
56 0.15
57 0.09
58 0.08
59 0.07
60 0.08
61 0.13
62 0.19
63 0.24
64 0.28
65 0.36
66 0.43
67 0.46
68 0.5
69 0.54
70 0.51
71 0.49
72 0.47
73 0.41
74 0.34
75 0.32
76 0.28
77 0.21
78 0.2
79 0.18
80 0.15
81 0.14
82 0.14
83 0.18
84 0.21
85 0.22
86 0.21
87 0.2
88 0.2
89 0.22
90 0.22
91 0.17
92 0.14
93 0.13
94 0.16
95 0.16
96 0.17
97 0.15
98 0.16
99 0.2
100 0.24
101 0.23
102 0.2
103 0.2
104 0.19
105 0.21
106 0.2
107 0.15
108 0.17
109 0.17
110 0.17
111 0.17
112 0.18
113 0.17
114 0.19
115 0.2
116 0.18
117 0.19
118 0.22
119 0.27
120 0.25
121 0.22
122 0.22
123 0.21
124 0.21
125 0.21
126 0.2
127 0.17
128 0.17
129 0.18
130 0.17
131 0.17
132 0.15
133 0.14
134 0.11
135 0.14
136 0.13
137 0.12
138 0.14
139 0.16
140 0.17
141 0.19
142 0.26
143 0.27
144 0.3
145 0.29
146 0.29
147 0.26
148 0.25
149 0.22
150 0.15
151 0.13
152 0.13
153 0.14
154 0.16
155 0.17
156 0.17
157 0.17
158 0.18
159 0.15
160 0.13
161 0.11
162 0.09
163 0.07
164 0.07
165 0.06
166 0.05
167 0.06
168 0.06
169 0.07
170 0.06
171 0.05
172 0.05
173 0.07
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.07
181 0.05
182 0.04
183 0.05
184 0.04
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.06
198 0.08
199 0.09
200 0.09
201 0.09
202 0.09
203 0.1
204 0.13
205 0.12
206 0.13
207 0.13
208 0.13
209 0.13
210 0.14
211 0.14
212 0.11
213 0.11
214 0.09
215 0.09
216 0.11
217 0.11
218 0.1
219 0.12
220 0.15
221 0.17
222 0.19
223 0.2
224 0.2
225 0.22
226 0.26
227 0.28
228 0.26
229 0.26
230 0.28
231 0.31
232 0.34
233 0.33
234 0.28
235 0.28
236 0.28
237 0.27
238 0.21
239 0.17
240 0.13
241 0.12
242 0.11
243 0.09
244 0.09
245 0.07
246 0.08
247 0.07
248 0.07
249 0.07
250 0.06
251 0.05
252 0.06
253 0.07
254 0.06
255 0.09
256 0.09
257 0.09
258 0.09
259 0.1
260 0.12
261 0.13
262 0.15
263 0.15
264 0.16
265 0.16
266 0.17
267 0.16
268 0.14
269 0.15
270 0.13
271 0.11
272 0.09
273 0.1
274 0.11
275 0.12
276 0.1
277 0.09
278 0.08
279 0.07
280 0.06
281 0.06
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.05
292 0.05
293 0.06
294 0.06
295 0.07
296 0.07
297 0.08
298 0.09
299 0.1
300 0.1
301 0.11
302 0.12
303 0.12
304 0.14
305 0.13
306 0.13
307 0.12
308 0.12
309 0.1
310 0.1
311 0.09
312 0.06
313 0.06
314 0.07
315 0.08
316 0.09
317 0.1
318 0.12
319 0.14
320 0.15
321 0.15
322 0.22
323 0.25
324 0.3
325 0.31
326 0.36
327 0.42
328 0.43
329 0.42
330 0.36
331 0.32
332 0.25
333 0.24
334 0.18
335 0.11
336 0.12
337 0.16
338 0.19
339 0.21
340 0.24
341 0.31
342 0.39
343 0.48
344 0.51
345 0.54
346 0.58
347 0.65
348 0.7
349 0.69
350 0.65
351 0.61
352 0.57
353 0.53
354 0.5
355 0.43
356 0.38
357 0.32
358 0.28
359 0.22
360 0.2
361 0.16
362 0.14
363 0.17
364 0.14
365 0.13
366 0.13
367 0.13
368 0.13
369 0.13
370 0.11
371 0.07
372 0.08
373 0.09
374 0.12
375 0.12
376 0.12
377 0.12
378 0.12
379 0.12
380 0.13
381 0.12
382 0.12
383 0.12
384 0.12
385 0.14
386 0.15
387 0.14
388 0.12
389 0.12
390 0.09
391 0.11
392 0.14
393 0.13
394 0.13
395 0.15
396 0.15
397 0.18
398 0.19
399 0.21
400 0.23
401 0.26
402 0.32
403 0.36
404 0.43
405 0.44
406 0.48
407 0.46
408 0.49
409 0.51
410 0.49
411 0.49
412 0.47
413 0.47
414 0.48
415 0.47
416 0.39
417 0.36
418 0.31
419 0.26
420 0.23
421 0.19
422 0.14
423 0.19
424 0.21
425 0.23
426 0.26
427 0.28
428 0.32
429 0.37
430 0.37
431 0.31
432 0.29
433 0.27
434 0.26
435 0.26
436 0.25
437 0.21
438 0.21
439 0.23
440 0.22
441 0.2
442 0.19
443 0.19
444 0.15
445 0.15
446 0.16
447 0.14
448 0.15
449 0.14
450 0.12
451 0.12
452 0.14
453 0.17
454 0.23
455 0.26
456 0.32
457 0.35
458 0.4
459 0.4
460 0.41
461 0.4
462 0.35
463 0.39
464 0.39