Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179I4K2

Protein Details
Accession A0A179I4K2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
209-235YRCSDEGRLRNEKRRDKRPPNLSFIHDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 10, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023346  Lysozyme-like_dom_sf  
Amino Acid Sequences MRPFTYLQAAILAAGMADAAKKPKLPDPLEPRPMNPEAEGACAVVQGGEHACGPNGCESWLNRGLETEGGWNPPYLNISSLVTIPIKEWYAGTGGDRCENLRLLWNLPGKTYNIPPILLAVLGYQESACDPLHRHYGVLRCKKGTCPNGDKKDKCEYPLETNADCAARNLRRWLDDSNDNIIYALGKYDDWFTAGCGRDDDDKRFTTDYRCSDEGRLRNEKRRDKRPPNLSFIHDTLNGWLQGHNLTDPAHPLRGKYSHLGNCTNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.03
4 0.04
5 0.06
6 0.09
7 0.11
8 0.13
9 0.16
10 0.22
11 0.32
12 0.35
13 0.44
14 0.51
15 0.6
16 0.67
17 0.66
18 0.62
19 0.59
20 0.58
21 0.49
22 0.4
23 0.34
24 0.25
25 0.27
26 0.25
27 0.19
28 0.16
29 0.14
30 0.13
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.08
40 0.09
41 0.11
42 0.11
43 0.11
44 0.14
45 0.15
46 0.22
47 0.28
48 0.27
49 0.24
50 0.24
51 0.24
52 0.22
53 0.22
54 0.18
55 0.13
56 0.14
57 0.15
58 0.14
59 0.13
60 0.14
61 0.15
62 0.11
63 0.11
64 0.11
65 0.11
66 0.12
67 0.12
68 0.13
69 0.11
70 0.11
71 0.1
72 0.11
73 0.1
74 0.1
75 0.1
76 0.09
77 0.09
78 0.1
79 0.1
80 0.11
81 0.12
82 0.13
83 0.13
84 0.13
85 0.14
86 0.14
87 0.13
88 0.15
89 0.16
90 0.15
91 0.21
92 0.25
93 0.23
94 0.23
95 0.24
96 0.21
97 0.22
98 0.22
99 0.22
100 0.18
101 0.18
102 0.17
103 0.17
104 0.15
105 0.13
106 0.11
107 0.06
108 0.05
109 0.05
110 0.05
111 0.04
112 0.03
113 0.04
114 0.05
115 0.05
116 0.06
117 0.07
118 0.09
119 0.13
120 0.13
121 0.14
122 0.15
123 0.22
124 0.3
125 0.37
126 0.37
127 0.36
128 0.37
129 0.41
130 0.47
131 0.46
132 0.45
133 0.46
134 0.54
135 0.62
136 0.7
137 0.67
138 0.63
139 0.66
140 0.6
141 0.53
142 0.48
143 0.42
144 0.39
145 0.45
146 0.44
147 0.35
148 0.34
149 0.33
150 0.28
151 0.24
152 0.19
153 0.18
154 0.16
155 0.18
156 0.22
157 0.23
158 0.24
159 0.27
160 0.28
161 0.27
162 0.3
163 0.31
164 0.31
165 0.3
166 0.28
167 0.25
168 0.23
169 0.18
170 0.13
171 0.1
172 0.06
173 0.05
174 0.06
175 0.07
176 0.08
177 0.08
178 0.08
179 0.09
180 0.14
181 0.15
182 0.15
183 0.14
184 0.16
185 0.23
186 0.27
187 0.3
188 0.29
189 0.29
190 0.31
191 0.33
192 0.32
193 0.3
194 0.35
195 0.35
196 0.37
197 0.38
198 0.38
199 0.41
200 0.47
201 0.48
202 0.48
203 0.54
204 0.53
205 0.61
206 0.68
207 0.74
208 0.76
209 0.81
210 0.84
211 0.84
212 0.88
213 0.89
214 0.87
215 0.85
216 0.8
217 0.75
218 0.69
219 0.6
220 0.55
221 0.45
222 0.38
223 0.33
224 0.31
225 0.27
226 0.21
227 0.2
228 0.16
229 0.17
230 0.18
231 0.15
232 0.13
233 0.14
234 0.14
235 0.19
236 0.21
237 0.26
238 0.25
239 0.26
240 0.31
241 0.33
242 0.36
243 0.36
244 0.42
245 0.43
246 0.48