Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179IA35

Protein Details
Accession A0A179IA35    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPSLKSFRTKQKLAKSQKQNRPVPQWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSLKSFRTKQKLAKSQKQNRPVPQWIRLRTNNSVRYAPSPNSTLSQLLEDEQTAWLTSVSPSTATTLSADIGERPSSASKCPSRCSPSFSFAVLFQIPKPRQVFRHSSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.86
4 0.88
5 0.89
6 0.87
7 0.85
8 0.83
9 0.83
10 0.78
11 0.76
12 0.75
13 0.71
14 0.71
15 0.68
16 0.66
17 0.64
18 0.66
19 0.63
20 0.58
21 0.54
22 0.47
23 0.46
24 0.44
25 0.38
26 0.32
27 0.27
28 0.25
29 0.24
30 0.24
31 0.2
32 0.16
33 0.15
34 0.13
35 0.12
36 0.11
37 0.09
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.09
60 0.08
61 0.08
62 0.09
63 0.12
64 0.13
65 0.15
66 0.22
67 0.27
68 0.3
69 0.35
70 0.41
71 0.45
72 0.46
73 0.51
74 0.49
75 0.47
76 0.45
77 0.43
78 0.36
79 0.29
80 0.32
81 0.26
82 0.22
83 0.2
84 0.28
85 0.27
86 0.33
87 0.37
88 0.37
89 0.41
90 0.48
91 0.54