Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S995

Protein Details
Accession Q7S995    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
221-240YLPNFKKRTLSKRRVPHVVNHydrophilic
279-307AEQERAEKAKQKKEEKKREREKEYVPPEEBasic
NLS Segment(s)
PositionSequence
283-317RAEKAKQKKEEKKREREKEYVPPEELTDKKAKKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041174  KH_8  
IPR004087  KH_dom  
IPR036612  KH_dom_type_1_sf  
IPR024166  rRNA_assembly_KRR1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0032040  C:small-subunit processome  
GO:0003723  F:RNA binding  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ncr:NCU07041  -  
Pfam View protein in Pfam  
PF17903  KH_8  
CDD cd22393  KH-I_KRR1_rpt1  
cd22394  KH-I_KRR1_rpt2  
Amino Acid Sequences MPSTHKKEKPWDTDDIDKWKVDPFTKDESSGPFLEESSFMTLFPKYRERYLRDSWPLITKALDKHGITAVLDLVEGSMTVKTTRKTYDPAAILNARDLIKLLARSVPAPQAIKILEDGMACDIIKIRSMVRNKERFVKRRQRILGQNGTTLKALELLTQTYILVHGNTVSVMGPFKGLKEVRRVVEDTMNNVHPIYMIKELMIKRELAKDPALAHEDWSRYLPNFKKRTLSKRRVPHVVNDKTKKNYTPFPPAPEKSKVDLQIESGEYFLGKEAKQRVAEQERAEKAKQKKEEKKREREKEYVPPEELTDKKAKKRKTSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.62
4 0.53
5 0.48
6 0.45
7 0.44
8 0.39
9 0.37
10 0.34
11 0.39
12 0.41
13 0.43
14 0.4
15 0.4
16 0.41
17 0.36
18 0.32
19 0.24
20 0.22
21 0.21
22 0.19
23 0.16
24 0.16
25 0.16
26 0.14
27 0.15
28 0.16
29 0.18
30 0.22
31 0.28
32 0.26
33 0.34
34 0.42
35 0.47
36 0.53
37 0.57
38 0.63
39 0.61
40 0.62
41 0.56
42 0.55
43 0.5
44 0.44
45 0.39
46 0.33
47 0.29
48 0.31
49 0.34
50 0.27
51 0.28
52 0.29
53 0.28
54 0.24
55 0.22
56 0.17
57 0.11
58 0.11
59 0.08
60 0.06
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.07
67 0.09
68 0.11
69 0.14
70 0.17
71 0.2
72 0.23
73 0.26
74 0.32
75 0.32
76 0.32
77 0.34
78 0.33
79 0.3
80 0.27
81 0.27
82 0.19
83 0.17
84 0.16
85 0.12
86 0.12
87 0.13
88 0.13
89 0.12
90 0.12
91 0.13
92 0.14
93 0.16
94 0.17
95 0.17
96 0.16
97 0.17
98 0.17
99 0.17
100 0.15
101 0.13
102 0.11
103 0.1
104 0.1
105 0.08
106 0.08
107 0.07
108 0.07
109 0.08
110 0.06
111 0.08
112 0.08
113 0.09
114 0.14
115 0.19
116 0.27
117 0.35
118 0.42
119 0.43
120 0.52
121 0.59
122 0.6
123 0.67
124 0.69
125 0.67
126 0.69
127 0.72
128 0.69
129 0.69
130 0.7
131 0.69
132 0.59
133 0.57
134 0.48
135 0.45
136 0.38
137 0.29
138 0.21
139 0.14
140 0.13
141 0.1
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.06
148 0.06
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.06
163 0.11
164 0.12
165 0.14
166 0.21
167 0.25
168 0.26
169 0.29
170 0.3
171 0.26
172 0.31
173 0.3
174 0.26
175 0.25
176 0.25
177 0.22
178 0.2
179 0.18
180 0.12
181 0.12
182 0.11
183 0.1
184 0.09
185 0.09
186 0.15
187 0.15
188 0.18
189 0.18
190 0.17
191 0.16
192 0.23
193 0.24
194 0.22
195 0.23
196 0.22
197 0.21
198 0.24
199 0.25
200 0.18
201 0.19
202 0.2
203 0.2
204 0.19
205 0.19
206 0.18
207 0.16
208 0.23
209 0.28
210 0.34
211 0.38
212 0.4
213 0.47
214 0.53
215 0.64
216 0.67
217 0.71
218 0.7
219 0.75
220 0.8
221 0.8
222 0.75
223 0.73
224 0.73
225 0.73
226 0.74
227 0.71
228 0.7
229 0.67
230 0.69
231 0.65
232 0.59
233 0.58
234 0.54
235 0.58
236 0.56
237 0.57
238 0.62
239 0.6
240 0.61
241 0.6
242 0.57
243 0.51
244 0.53
245 0.5
246 0.44
247 0.42
248 0.38
249 0.36
250 0.34
251 0.3
252 0.23
253 0.18
254 0.15
255 0.14
256 0.13
257 0.11
258 0.1
259 0.16
260 0.21
261 0.27
262 0.29
263 0.32
264 0.4
265 0.44
266 0.5
267 0.49
268 0.53
269 0.53
270 0.56
271 0.56
272 0.55
273 0.56
274 0.6
275 0.64
276 0.66
277 0.71
278 0.77
279 0.86
280 0.88
281 0.91
282 0.93
283 0.94
284 0.91
285 0.89
286 0.86
287 0.85
288 0.83
289 0.79
290 0.71
291 0.61
292 0.56
293 0.55
294 0.49
295 0.44
296 0.45
297 0.45
298 0.52
299 0.59
300 0.64