FuNGI

A0A179IUA6

Protein Details

Accession

A0A179IUA6

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
468-496	NGELKKVPPKAPPPRRRGKMKVAEAPPIE	Hydrophilic

NLS Segment(s)

Position	Sequence
443-488	KKPLPVVPKHRHGVPFKELANRSAANGELKKVPPKAPPPRRRGKMK

Subcellular Location(s)

nucl 17, cyto_nucl 12.833, mito_nucl 9.333, cyto 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR030125 SPIN90/Ldb17 IPR018556 SPIN90/Ldb17_LRD
Pfam	View protein in Pfam PF09431 SPIN90_LRD

Amino Acid Sequences

MAMADVEEIPFSAEEEQQLWTDIGTCVSSPCDDHESIDDALRTWLELTARLRGRLPGSQEDSILCAQMLIKSQLFQQNQEYVRTQLIHSLLQEDDIPYLHAITSLLLLDGHYDGAIFPRMNEESCFPRLVELIAARQDDEDPRLHRFLLQLMYEMSRVERLRPEELVLVDDGFIHSLFRIIEGVSNDVHDPYHYPTIRVLLVMNEQYMLASTDPVEGPDGTQAPLTNRIVKCLSLHGPSFRTFGENIILLLNRETETSLQLLILKLLYLLFTTKATYEYFYTNDLRVLLDVIIRNLMDLPDERISLRHTYLRVLYPLLAHTQLSHPPHYKQDEILKVLKVLRGSLNAHFAPADDTTVRLVDRVAKVKWLVVGNMDGASEVARKFLGISLSPAQYASSVSVGDVAGVMEKPGVQTPSRNGDSGARGQDFPSPTQDEVSKTVRAKKPLPVVPKHRHGVPFKELANRSAANGELKKVPPKAPPPRRRGKMKVAEAPPIETITETPRE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.13
3	0.14
4	0.14
5	0.15
6	0.14
7	0.12
8	0.13
9	0.12
10	0.12
11	0.11
12	0.11
13	0.1
14	0.12
15	0.13
16	0.12
17	0.16
18	0.2
19	0.2
20	0.22
21	0.24
22	0.26
23	0.26
24	0.28
25	0.24
26	0.19
27	0.2
28	0.18
29	0.16
30	0.12
31	0.14
32	0.11
33	0.16
34	0.18
35	0.25
36	0.28
37	0.3
38	0.31
39	0.33
40	0.36
41	0.35
42	0.39
43	0.39
44	0.42
45	0.41
46	0.41
47	0.37
48	0.36
49	0.32
50	0.26
51	0.17
52	0.12
53	0.11
54	0.12
55	0.15
56	0.15
57	0.16
58	0.16
59	0.21
60	0.29
61	0.3
62	0.3
63	0.32
64	0.36
65	0.37
66	0.41
67	0.38
68	0.32
69	0.33
70	0.32
71	0.27
72	0.24
73	0.25
74	0.23
75	0.21
76	0.22
77	0.18
78	0.18
79	0.18
80	0.14
81	0.12
82	0.11
83	0.11
84	0.09
85	0.09
86	0.08
87	0.08
88	0.07
89	0.07
90	0.07
91	0.06
92	0.06
93	0.06
94	0.06
95	0.07
96	0.07
97	0.07
98	0.05
99	0.05
100	0.05
101	0.07
102	0.1
103	0.09
104	0.08
105	0.13
106	0.14
107	0.15
108	0.16
109	0.18
110	0.2
111	0.22
112	0.23
113	0.19
114	0.19
115	0.18
116	0.17
117	0.18
118	0.14
119	0.15
120	0.17
121	0.17
122	0.17
123	0.17
124	0.18
125	0.16
126	0.17
127	0.19
128	0.17
129	0.21
130	0.22
131	0.22
132	0.22
133	0.21
134	0.22
135	0.22
136	0.2
137	0.17
138	0.17
139	0.18
140	0.17
141	0.16
142	0.13
143	0.14
144	0.14
145	0.15
146	0.19
147	0.21
148	0.23
149	0.24
150	0.25
151	0.23
152	0.22
153	0.21
154	0.17
155	0.13
156	0.11
157	0.1
158	0.09
159	0.06
160	0.06
161	0.05
162	0.04
163	0.05
164	0.05
165	0.06
166	0.06
167	0.06
168	0.08
169	0.09
170	0.11
171	0.09
172	0.1
173	0.1
174	0.1
175	0.1
176	0.08
177	0.09
178	0.11
179	0.19
180	0.18
181	0.18
182	0.19
183	0.21
184	0.21
185	0.2
186	0.17
187	0.1
188	0.12
189	0.12
190	0.11
191	0.09
192	0.09
193	0.08
194	0.08
195	0.08
196	0.05
197	0.05
198	0.05
199	0.06
200	0.06
201	0.07
202	0.08
203	0.07
204	0.07
205	0.08
206	0.09
207	0.08
208	0.08
209	0.09
210	0.09
211	0.14
212	0.15
213	0.21
214	0.2
215	0.22
216	0.23
217	0.23
218	0.22
219	0.21
220	0.23
221	0.18
222	0.19
223	0.19
224	0.2
225	0.21
226	0.22
227	0.18
228	0.17
229	0.14
230	0.14
231	0.13
232	0.11
233	0.1
234	0.09
235	0.09
236	0.08
237	0.08
238	0.07
239	0.06
240	0.06
241	0.06
242	0.06
243	0.07
244	0.07
245	0.07
246	0.06
247	0.07
248	0.07
249	0.07
250	0.06
251	0.05
252	0.05
253	0.04
254	0.04
255	0.04
256	0.04
257	0.05
258	0.05
259	0.06
260	0.06
261	0.08
262	0.08
263	0.09
264	0.1
265	0.11
266	0.12
267	0.14
268	0.16
269	0.15
270	0.15
271	0.14
272	0.12
273	0.11
274	0.11
275	0.08
276	0.08
277	0.08
278	0.08
279	0.08
280	0.08
281	0.08
282	0.07
283	0.07
284	0.06
285	0.06
286	0.09
287	0.1
288	0.1
289	0.1
290	0.11
291	0.14
292	0.15
293	0.16
294	0.16
295	0.16
296	0.17
297	0.2
298	0.21
299	0.2
300	0.19
301	0.17
302	0.15
303	0.15
304	0.15
305	0.13
306	0.11
307	0.11
308	0.12
309	0.17
310	0.19
311	0.22
312	0.23
313	0.25
314	0.31
315	0.34
316	0.33
317	0.31
318	0.36
319	0.37
320	0.38
321	0.4
322	0.34
323	0.32
324	0.33
325	0.31
326	0.23
327	0.2
328	0.18
329	0.18
330	0.2
331	0.2
332	0.24
333	0.22
334	0.22
335	0.2
336	0.18
337	0.17
338	0.14
339	0.15
340	0.09
341	0.1
342	0.1
343	0.11
344	0.11
345	0.09
346	0.09
347	0.13
348	0.17
349	0.22
350	0.21
351	0.24
352	0.24
353	0.25
354	0.29
355	0.24
356	0.2
357	0.17
358	0.18
359	0.15
360	0.15
361	0.14
362	0.09
363	0.08
364	0.08
365	0.09
366	0.07
367	0.07
368	0.07
369	0.07
370	0.08
371	0.1
372	0.11
373	0.1
374	0.15
375	0.18
376	0.19
377	0.19
378	0.19
379	0.17
380	0.15
381	0.15
382	0.12
383	0.09
384	0.08
385	0.08
386	0.09
387	0.08
388	0.08
389	0.07
390	0.06
391	0.06
392	0.06
393	0.06
394	0.05
395	0.05
396	0.06
397	0.09
398	0.12
399	0.12
400	0.16
401	0.21
402	0.29
403	0.31
404	0.31
405	0.3
406	0.32
407	0.36
408	0.38
409	0.39
410	0.32
411	0.31
412	0.31
413	0.36
414	0.33
415	0.3
416	0.3
417	0.28
418	0.26
419	0.28
420	0.3
421	0.27
422	0.3
423	0.32
424	0.32
425	0.33
426	0.42
427	0.45
428	0.5
429	0.51
430	0.53
431	0.59
432	0.61
433	0.66
434	0.66
435	0.71
436	0.73
437	0.78
438	0.74
439	0.71
440	0.71
441	0.68
442	0.66
443	0.63
444	0.6
445	0.55
446	0.6
447	0.56
448	0.49
449	0.49
450	0.42
451	0.37
452	0.32
453	0.31
454	0.29
455	0.29
456	0.3
457	0.3
458	0.34
459	0.39
460	0.42
461	0.45
462	0.46
463	0.55
464	0.63
465	0.68
466	0.75
467	0.78
468	0.84
469	0.88
470	0.9
471	0.88
472	0.88
473	0.87
474	0.87
475	0.87
476	0.81
477	0.8
478	0.72
479	0.66
480	0.56
481	0.47
482	0.37
483	0.28
484	0.25

A0A179IUA6

3D AlphaFold-predicted Structure Viewer