Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179I498

Protein Details
Accession A0A179I498    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
125-152VKKGEVLRKPKNQQQQQQQVVKKRKRSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8, cyto_nucl 6.5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019446  BMT5-like  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0070042  F:rRNA (uridine-N3-)-methyltransferase activity  
GO:0070475  P:rRNA base methylation  
Pfam View protein in Pfam  
PF10354  BMT5-like  
Amino Acid Sequences RPYDRILFNFPHVGGKSTDVNRQVRHNQELLVAFFRRAVPLLAPGGSIVVTLFDGEPYTLWNVKDLARHVGLQADASFRFMARAYPGYRHARTIGVIRSKKAGGGAESGGAWRGEDRPARSYVFVKKGEVLRKPKNQQQQQQQVVKKRKRSGSDDEADSSEDDLDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.32
4 0.3
5 0.36
6 0.36
7 0.4
8 0.41
9 0.47
10 0.52
11 0.52
12 0.54
13 0.49
14 0.43
15 0.42
16 0.42
17 0.36
18 0.33
19 0.26
20 0.21
21 0.22
22 0.21
23 0.17
24 0.16
25 0.14
26 0.11
27 0.13
28 0.14
29 0.13
30 0.12
31 0.11
32 0.11
33 0.09
34 0.09
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.08
46 0.1
47 0.1
48 0.11
49 0.12
50 0.13
51 0.16
52 0.17
53 0.18
54 0.17
55 0.17
56 0.16
57 0.17
58 0.15
59 0.13
60 0.12
61 0.1
62 0.08
63 0.09
64 0.09
65 0.07
66 0.08
67 0.07
68 0.08
69 0.08
70 0.11
71 0.11
72 0.13
73 0.2
74 0.25
75 0.26
76 0.27
77 0.26
78 0.24
79 0.24
80 0.25
81 0.25
82 0.27
83 0.28
84 0.28
85 0.29
86 0.28
87 0.27
88 0.25
89 0.21
90 0.13
91 0.14
92 0.14
93 0.12
94 0.12
95 0.11
96 0.1
97 0.09
98 0.08
99 0.06
100 0.07
101 0.11
102 0.15
103 0.18
104 0.2
105 0.23
106 0.25
107 0.26
108 0.29
109 0.33
110 0.36
111 0.35
112 0.33
113 0.36
114 0.4
115 0.45
116 0.49
117 0.51
118 0.53
119 0.61
120 0.67
121 0.7
122 0.75
123 0.77
124 0.79
125 0.8
126 0.82
127 0.81
128 0.83
129 0.82
130 0.82
131 0.83
132 0.82
133 0.8
134 0.78
135 0.77
136 0.76
137 0.76
138 0.75
139 0.75
140 0.74
141 0.69
142 0.63
143 0.56
144 0.5
145 0.43
146 0.34