Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HZB6

Protein Details
Accession A0A179HZB6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MGRELQKKKRRSGRQPIRQSNKTKKILNPRGNNHydrophilic
NLS Segment(s)
PositionSequence
7-25KKKRRSGRQPIRQSNKTKK
Subcellular Location(s) nucl 15, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MGRELQKKKRRSGRQPIRQSNKTKKILNPRGNNIIADNWDKKSTLSQNYRRLGLVSRLRAPTGGHEEWGGIVDARHDDGMTDVVRGLVEQARNPAPKRARHLSEREAEWLHKLVARHGDDTRAMARDARLNPMQQTAADIARRLKKLNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.94
4 0.94
5 0.91
6 0.9
7 0.9
8 0.89
9 0.86
10 0.81
11 0.78
12 0.79
13 0.81
14 0.81
15 0.79
16 0.75
17 0.76
18 0.7
19 0.63
20 0.53
21 0.44
22 0.37
23 0.34
24 0.3
25 0.24
26 0.24
27 0.23
28 0.22
29 0.26
30 0.3
31 0.34
32 0.41
33 0.47
34 0.56
35 0.58
36 0.59
37 0.53
38 0.47
39 0.4
40 0.39
41 0.37
42 0.31
43 0.34
44 0.33
45 0.33
46 0.32
47 0.3
48 0.26
49 0.27
50 0.23
51 0.18
52 0.18
53 0.17
54 0.17
55 0.17
56 0.13
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.08
76 0.08
77 0.12
78 0.16
79 0.2
80 0.21
81 0.28
82 0.31
83 0.35
84 0.42
85 0.47
86 0.48
87 0.52
88 0.58
89 0.57
90 0.57
91 0.53
92 0.5
93 0.44
94 0.39
95 0.35
96 0.29
97 0.23
98 0.2
99 0.18
100 0.18
101 0.24
102 0.26
103 0.27
104 0.26
105 0.29
106 0.27
107 0.3
108 0.29
109 0.22
110 0.21
111 0.19
112 0.2
113 0.25
114 0.25
115 0.29
116 0.3
117 0.3
118 0.32
119 0.33
120 0.32
121 0.25
122 0.27
123 0.23
124 0.24
125 0.23
126 0.24
127 0.28
128 0.34
129 0.36