Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167Z8R5

Protein Details
Accession A0A167Z8R5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-48NPDQPTKKKHLPFSSINRHQFIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 4, pero 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013893  RNase_P_Rpp40  
Gene Ontology GO:0030677  C:ribonuclease P complex  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF08584  Ribonuc_P_40  
Amino Acid Sequences MIDLEPSEDFQRDFCRTSYGSLPQFVNPDQPTKKKHLPFSSINRHQFIHDLQLVIPQDDYDAAWDSRLKDISVFQYAKLNAPLSALLDGDFLNQYIKAGNILMISEGRPGVDTIYTLSDGILRIELDKSIYEKVGIVGKAVKHGGRTHVKERYLIELNLRLPSMLHGKKGFEKLVWASKQVLTDPVTWLFCDLNPTPDYTEKAPISQLNPKIITVSPELSTRRHTLVPPLDPTSSTYNPPSPSASQATDKHAIQSLSQDFLKQTTDDLSEWLALVALDSDRVRSDDTIDPYLSRYELPTIKEECKEQHLLSLRWKGLIPAEWILRLFVSLLRHVQSPNTSPNSWFALTSSAFPRKAMDNDKGYTILSPPQNDHSQNAEIRRKYVLWEYAGGMGFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.29
4 0.33
5 0.37
6 0.39
7 0.38
8 0.41
9 0.42
10 0.38
11 0.42
12 0.39
13 0.4
14 0.34
15 0.39
16 0.42
17 0.48
18 0.51
19 0.55
20 0.64
21 0.63
22 0.71
23 0.71
24 0.71
25 0.73
26 0.78
27 0.81
28 0.81
29 0.8
30 0.73
31 0.65
32 0.58
33 0.53
34 0.44
35 0.41
36 0.34
37 0.28
38 0.25
39 0.3
40 0.3
41 0.26
42 0.24
43 0.15
44 0.13
45 0.12
46 0.12
47 0.09
48 0.11
49 0.11
50 0.12
51 0.15
52 0.16
53 0.2
54 0.21
55 0.19
56 0.17
57 0.21
58 0.23
59 0.3
60 0.29
61 0.25
62 0.31
63 0.31
64 0.32
65 0.32
66 0.29
67 0.2
68 0.21
69 0.2
70 0.15
71 0.15
72 0.12
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.08
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.09
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.07
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.1
116 0.11
117 0.11
118 0.1
119 0.1
120 0.11
121 0.15
122 0.14
123 0.13
124 0.15
125 0.15
126 0.17
127 0.18
128 0.18
129 0.16
130 0.17
131 0.24
132 0.29
133 0.34
134 0.38
135 0.43
136 0.44
137 0.45
138 0.44
139 0.43
140 0.38
141 0.34
142 0.29
143 0.27
144 0.27
145 0.25
146 0.23
147 0.17
148 0.13
149 0.15
150 0.21
151 0.18
152 0.2
153 0.2
154 0.22
155 0.26
156 0.29
157 0.28
158 0.2
159 0.22
160 0.22
161 0.28
162 0.27
163 0.25
164 0.23
165 0.24
166 0.25
167 0.22
168 0.22
169 0.17
170 0.17
171 0.17
172 0.17
173 0.15
174 0.14
175 0.15
176 0.12
177 0.1
178 0.13
179 0.12
180 0.13
181 0.13
182 0.14
183 0.15
184 0.16
185 0.18
186 0.15
187 0.2
188 0.16
189 0.17
190 0.18
191 0.18
192 0.19
193 0.24
194 0.25
195 0.23
196 0.24
197 0.23
198 0.23
199 0.22
200 0.22
201 0.17
202 0.16
203 0.13
204 0.16
205 0.18
206 0.18
207 0.21
208 0.2
209 0.21
210 0.21
211 0.21
212 0.25
213 0.29
214 0.31
215 0.31
216 0.31
217 0.29
218 0.28
219 0.3
220 0.29
221 0.25
222 0.23
223 0.23
224 0.24
225 0.25
226 0.26
227 0.26
228 0.21
229 0.23
230 0.24
231 0.24
232 0.26
233 0.27
234 0.31
235 0.32
236 0.3
237 0.28
238 0.28
239 0.26
240 0.21
241 0.25
242 0.21
243 0.2
244 0.2
245 0.19
246 0.16
247 0.17
248 0.18
249 0.12
250 0.11
251 0.11
252 0.13
253 0.12
254 0.13
255 0.13
256 0.11
257 0.11
258 0.1
259 0.08
260 0.06
261 0.05
262 0.05
263 0.04
264 0.06
265 0.06
266 0.07
267 0.07
268 0.08
269 0.1
270 0.09
271 0.14
272 0.18
273 0.22
274 0.24
275 0.24
276 0.24
277 0.24
278 0.24
279 0.21
280 0.15
281 0.13
282 0.15
283 0.18
284 0.2
285 0.24
286 0.28
287 0.31
288 0.32
289 0.34
290 0.32
291 0.34
292 0.36
293 0.31
294 0.33
295 0.36
296 0.37
297 0.42
298 0.47
299 0.41
300 0.39
301 0.39
302 0.33
303 0.3
304 0.31
305 0.27
306 0.23
307 0.24
308 0.23
309 0.24
310 0.23
311 0.19
312 0.16
313 0.13
314 0.11
315 0.12
316 0.14
317 0.17
318 0.18
319 0.2
320 0.2
321 0.23
322 0.25
323 0.27
324 0.33
325 0.36
326 0.35
327 0.34
328 0.38
329 0.39
330 0.35
331 0.31
332 0.23
333 0.23
334 0.22
335 0.25
336 0.28
337 0.3
338 0.3
339 0.3
340 0.32
341 0.31
342 0.38
343 0.41
344 0.42
345 0.41
346 0.43
347 0.45
348 0.43
349 0.39
350 0.33
351 0.28
352 0.27
353 0.26
354 0.27
355 0.28
356 0.33
357 0.39
358 0.4
359 0.41
360 0.4
361 0.41
362 0.43
363 0.5
364 0.53
365 0.48
366 0.48
367 0.49
368 0.44
369 0.42
370 0.45
371 0.42
372 0.36
373 0.37
374 0.37
375 0.38