Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167YR81

Protein Details
Accession A0A167YR81    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-107VEYVKKTKEEEKAERKRRRKERRREEWKKWTYDPNABasic
NLS Segment(s)
PositionSequence
77-99KTKEEEKAERKRRRKERRREEWK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MSPLLNRVSKWCHGSHYHQLAGESSSHTESQTEPPPYTELDDRRRRSSSPLNSSEHDGDEPIERVSTCSTYVEYVKKTKEEEKAERKRRRKERRREEWKKWTYDPNAYIVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.52
4 0.5
5 0.46
6 0.45
7 0.41
8 0.36
9 0.3
10 0.21
11 0.16
12 0.16
13 0.15
14 0.14
15 0.14
16 0.14
17 0.18
18 0.24
19 0.25
20 0.23
21 0.24
22 0.25
23 0.25
24 0.26
25 0.26
26 0.26
27 0.33
28 0.42
29 0.44
30 0.48
31 0.49
32 0.47
33 0.48
34 0.51
35 0.51
36 0.5
37 0.52
38 0.5
39 0.49
40 0.51
41 0.46
42 0.37
43 0.27
44 0.19
45 0.14
46 0.12
47 0.12
48 0.09
49 0.08
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.11
58 0.14
59 0.16
60 0.18
61 0.22
62 0.23
63 0.25
64 0.28
65 0.32
66 0.38
67 0.43
68 0.5
69 0.56
70 0.65
71 0.74
72 0.81
73 0.84
74 0.87
75 0.89
76 0.91
77 0.91
78 0.91
79 0.92
80 0.93
81 0.95
82 0.95
83 0.95
84 0.94
85 0.93
86 0.89
87 0.83
88 0.81
89 0.77
90 0.75
91 0.67
92 0.6