Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168AZF3

Protein Details
Accession A0A168AZF3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-94GRNGARKNGKRNGTKKEPLRSRRSBasic
NLS Segment(s)
PositionSequence
26-94GKLMKKGLHKVDRAASKAALKGIDAGVAATRKTKKSMGINGKGRNGRNGARKNGKRNGTKKEPLRSRRS
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MPKVGLPNFFRPTAFSTSAELQSRPGKLMKKGLHKVDRAASKAALKGIDAGVAATRKTKKSMGINGKGRNGRNGARKNGKRNGTKKEPLRSRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.29
3 0.29
4 0.31
5 0.36
6 0.35
7 0.31
8 0.28
9 0.29
10 0.28
11 0.26
12 0.27
13 0.26
14 0.28
15 0.37
16 0.4
17 0.46
18 0.51
19 0.58
20 0.61
21 0.58
22 0.58
23 0.55
24 0.53
25 0.45
26 0.4
27 0.33
28 0.27
29 0.27
30 0.24
31 0.18
32 0.13
33 0.12
34 0.1
35 0.09
36 0.07
37 0.06
38 0.06
39 0.07
40 0.07
41 0.1
42 0.13
43 0.13
44 0.16
45 0.18
46 0.23
47 0.29
48 0.39
49 0.45
50 0.52
51 0.59
52 0.62
53 0.67
54 0.67
55 0.61
56 0.56
57 0.51
58 0.48
59 0.49
60 0.51
61 0.54
62 0.6
63 0.66
64 0.71
65 0.75
66 0.78
67 0.78
68 0.79
69 0.79
70 0.78
71 0.8
72 0.79
73 0.82
74 0.83