Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167ZGW0

Protein Details
Accession A0A167ZGW0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-99QSGNKISKGRNKGKTRRTWAPHHydrophilic
NLS Segment(s)
PositionSequence
85-94KGRNKGKTRR
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MASSLRSLMLGQSALRSTSVTASTLPLTTRLFSTSTPTPAKQASSSRYLPPGVPEYPYGPNINFEPANWGLYGGSTLQSGNKISKGRNKGKTRRTWAPHIKIEKLHSDALNRDIKVRVQSRVLRTIQKCGGLDNYLLGEKPARIQELGVFGWKLRWEVMNSPAMVEKLRKERDELGAAFPITYDEYKIAKMNQYTDDINAFLAKLAEFETLQKENPEAVENEEPPQWTPELLAKKAWLNQMHAEMAAAQEAQLAAQEAQEIGETEATTAPASEETQQAVSSQSQQQNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.13
5 0.15
6 0.16
7 0.14
8 0.14
9 0.15
10 0.16
11 0.17
12 0.17
13 0.17
14 0.17
15 0.17
16 0.17
17 0.17
18 0.17
19 0.17
20 0.22
21 0.23
22 0.29
23 0.32
24 0.32
25 0.34
26 0.35
27 0.37
28 0.35
29 0.38
30 0.35
31 0.38
32 0.4
33 0.4
34 0.41
35 0.4
36 0.36
37 0.33
38 0.34
39 0.28
40 0.27
41 0.25
42 0.25
43 0.27
44 0.29
45 0.27
46 0.22
47 0.23
48 0.22
49 0.25
50 0.21
51 0.18
52 0.21
53 0.2
54 0.2
55 0.18
56 0.17
57 0.13
58 0.13
59 0.13
60 0.08
61 0.07
62 0.06
63 0.07
64 0.07
65 0.09
66 0.11
67 0.12
68 0.16
69 0.18
70 0.22
71 0.3
72 0.39
73 0.47
74 0.56
75 0.65
76 0.7
77 0.77
78 0.83
79 0.83
80 0.83
81 0.79
82 0.8
83 0.8
84 0.78
85 0.76
86 0.71
87 0.66
88 0.6
89 0.57
90 0.51
91 0.44
92 0.39
93 0.32
94 0.29
95 0.27
96 0.29
97 0.31
98 0.27
99 0.25
100 0.23
101 0.24
102 0.28
103 0.3
104 0.26
105 0.27
106 0.33
107 0.35
108 0.41
109 0.42
110 0.43
111 0.42
112 0.45
113 0.41
114 0.39
115 0.35
116 0.29
117 0.28
118 0.21
119 0.2
120 0.14
121 0.12
122 0.09
123 0.09
124 0.08
125 0.07
126 0.06
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.12
134 0.13
135 0.11
136 0.1
137 0.09
138 0.11
139 0.11
140 0.1
141 0.08
142 0.09
143 0.1
144 0.12
145 0.16
146 0.18
147 0.17
148 0.17
149 0.18
150 0.17
151 0.16
152 0.15
153 0.15
154 0.2
155 0.24
156 0.24
157 0.26
158 0.29
159 0.33
160 0.36
161 0.34
162 0.27
163 0.26
164 0.25
165 0.22
166 0.18
167 0.15
168 0.11
169 0.1
170 0.08
171 0.08
172 0.09
173 0.1
174 0.12
175 0.13
176 0.16
177 0.17
178 0.19
179 0.2
180 0.22
181 0.21
182 0.21
183 0.21
184 0.17
185 0.16
186 0.13
187 0.1
188 0.08
189 0.07
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.09
196 0.13
197 0.14
198 0.15
199 0.15
200 0.15
201 0.15
202 0.15
203 0.16
204 0.12
205 0.16
206 0.2
207 0.2
208 0.21
209 0.22
210 0.22
211 0.21
212 0.22
213 0.17
214 0.13
215 0.13
216 0.18
217 0.23
218 0.23
219 0.24
220 0.24
221 0.27
222 0.32
223 0.37
224 0.34
225 0.31
226 0.34
227 0.36
228 0.34
229 0.31
230 0.26
231 0.2
232 0.17
233 0.14
234 0.1
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.06
242 0.07
243 0.07
244 0.07
245 0.07
246 0.08
247 0.08
248 0.07
249 0.09
250 0.09
251 0.09
252 0.1
253 0.11
254 0.1
255 0.09
256 0.09
257 0.09
258 0.11
259 0.12
260 0.13
261 0.14
262 0.15
263 0.16
264 0.15
265 0.16
266 0.17
267 0.2
268 0.27