Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167WMM7

Protein Details
Accession A0A167WMM7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNSSQHNQNKKAHRNGIKKPKTHHydrophilic
NLS Segment(s)
PositionSequence
14-61KKAHRNGIKKPKTHRYPSLKGVDSKFRRNHRHALHGTMKALKEAKEGK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQNKKAHRNGIKKPKTHRYPSLKGVDSKFRRNHRHALHGTMKALKEAKEGKRTVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.83
4 0.83
5 0.81
6 0.82
7 0.85
8 0.82
9 0.79
10 0.79
11 0.8
12 0.78
13 0.76
14 0.76
15 0.73
16 0.71
17 0.73
18 0.71
19 0.63
20 0.58
21 0.54
22 0.54
23 0.49
24 0.52
25 0.51
26 0.53
27 0.59
28 0.6
29 0.67
30 0.62
31 0.68
32 0.63
33 0.64
34 0.62
35 0.57
36 0.54
37 0.5
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.41
45 0.45