Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167UTZ1

Protein Details
Accession A0A167UTZ1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-37NKRSSKFGLGRSKSKKNPLTHydrophilic
NLS Segment(s)
PositionSequence
260-266RKAPPRR
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MPSLLSKGEGDAAPSTSNKRSSKFGLGRSKSKKNPLTEIKVDLHESHAEKEARRLKSYADPNMAVNQLEPSAMQMTETTMESLSMRQHRDIYGNPIVDPDLSNPTRHRLERPLDTIRAFEAAIEDSYSSRRLSYGSKSERRSSNYDHRFGYPSNPEALTTPTSTVPGAPRRPHGHHHNSASTTSSPSSSHYDDDDHLGPSSAAGGAVQPPPTTFGNNPYGYGNAGVGSSRSRHFITPPAGQYPTPPTSQAGMAWASAPARKAPPRRPVEGGPDDKGGRSRSALEGRSIETRSTTKTEAWNRIDHAVETEIWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.25
4 0.33
5 0.35
6 0.36
7 0.4
8 0.44
9 0.52
10 0.55
11 0.59
12 0.62
13 0.65
14 0.72
15 0.75
16 0.8
17 0.77
18 0.8
19 0.78
20 0.73
21 0.76
22 0.76
23 0.76
24 0.71
25 0.69
26 0.62
27 0.58
28 0.54
29 0.45
30 0.38
31 0.34
32 0.31
33 0.27
34 0.31
35 0.3
36 0.28
37 0.37
38 0.42
39 0.41
40 0.42
41 0.41
42 0.38
43 0.44
44 0.52
45 0.5
46 0.48
47 0.44
48 0.43
49 0.46
50 0.43
51 0.34
52 0.26
53 0.19
54 0.14
55 0.12
56 0.11
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.09
63 0.1
64 0.11
65 0.1
66 0.08
67 0.09
68 0.09
69 0.1
70 0.15
71 0.19
72 0.2
73 0.21
74 0.23
75 0.24
76 0.27
77 0.28
78 0.3
79 0.3
80 0.28
81 0.27
82 0.26
83 0.24
84 0.21
85 0.2
86 0.14
87 0.16
88 0.17
89 0.19
90 0.19
91 0.24
92 0.29
93 0.3
94 0.32
95 0.32
96 0.37
97 0.41
98 0.46
99 0.46
100 0.44
101 0.43
102 0.39
103 0.32
104 0.27
105 0.21
106 0.15
107 0.1
108 0.08
109 0.08
110 0.07
111 0.07
112 0.06
113 0.08
114 0.09
115 0.08
116 0.08
117 0.08
118 0.09
119 0.12
120 0.16
121 0.25
122 0.32
123 0.39
124 0.43
125 0.48
126 0.51
127 0.53
128 0.53
129 0.51
130 0.52
131 0.52
132 0.52
133 0.48
134 0.46
135 0.43
136 0.39
137 0.37
138 0.29
139 0.23
140 0.22
141 0.2
142 0.18
143 0.17
144 0.18
145 0.15
146 0.13
147 0.12
148 0.11
149 0.11
150 0.11
151 0.11
152 0.13
153 0.18
154 0.23
155 0.23
156 0.29
157 0.34
158 0.37
159 0.42
160 0.48
161 0.5
162 0.52
163 0.54
164 0.53
165 0.49
166 0.46
167 0.42
168 0.34
169 0.27
170 0.2
171 0.17
172 0.13
173 0.14
174 0.18
175 0.17
176 0.17
177 0.17
178 0.18
179 0.18
180 0.21
181 0.19
182 0.16
183 0.14
184 0.14
185 0.12
186 0.1
187 0.1
188 0.06
189 0.05
190 0.04
191 0.04
192 0.06
193 0.08
194 0.09
195 0.08
196 0.09
197 0.12
198 0.13
199 0.15
200 0.14
201 0.18
202 0.25
203 0.25
204 0.26
205 0.24
206 0.24
207 0.21
208 0.21
209 0.16
210 0.08
211 0.08
212 0.07
213 0.07
214 0.08
215 0.09
216 0.1
217 0.13
218 0.14
219 0.15
220 0.17
221 0.24
222 0.28
223 0.32
224 0.35
225 0.36
226 0.36
227 0.35
228 0.36
229 0.36
230 0.33
231 0.27
232 0.26
233 0.23
234 0.23
235 0.24
236 0.21
237 0.17
238 0.15
239 0.14
240 0.13
241 0.12
242 0.12
243 0.12
244 0.13
245 0.13
246 0.19
247 0.27
248 0.35
249 0.43
250 0.52
251 0.57
252 0.62
253 0.64
254 0.63
255 0.65
256 0.66
257 0.62
258 0.55
259 0.54
260 0.49
261 0.45
262 0.45
263 0.37
264 0.3
265 0.27
266 0.27
267 0.29
268 0.36
269 0.37
270 0.37
271 0.37
272 0.37
273 0.41
274 0.39
275 0.32
276 0.29
277 0.29
278 0.29
279 0.32
280 0.32
281 0.3
282 0.38
283 0.47
284 0.52
285 0.55
286 0.55
287 0.53
288 0.55
289 0.53
290 0.44
291 0.38
292 0.31