Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VWD2

Protein Details
Accession A0A167VWD2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-180EAPEKSKEEKRQEEEKRRIRKENRERKKKGLPLLDEBasic
NLS Segment(s)
PositionSequence
149-174KSKEEKRQEEEKRRIRKENRERKKKG
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
IPR034012  Zn_ribbon_RPB9_C  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
GO:0006379  P:mRNA cleavage  
Pfam View protein in Pfam  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS51133  ZF_TFIIS_2  
CDD cd10508  Zn-ribbon_RPB9  
Amino Acid Sequences MSSSSPYPLQDYDESAFQATDIISNEPVIHESDTLTYFRFCHECSNLLYPKVDPESQTLLDFCQTCHTTQAAVSNCVFQNKVNSMLGATAGFTKDVASDPTLPRSRTKCPRCPSQESVYFQSQLRTADIGMRLYYVCCECGTVFEAPEKSKEEKRQEEEKRRIRKENRERKKKGLPLLDEKTGDVVVDGPDLNPPPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.21
4 0.16
5 0.15
6 0.11
7 0.11
8 0.11
9 0.12
10 0.11
11 0.12
12 0.12
13 0.12
14 0.13
15 0.12
16 0.11
17 0.1
18 0.1
19 0.12
20 0.13
21 0.14
22 0.14
23 0.13
24 0.12
25 0.14
26 0.16
27 0.15
28 0.2
29 0.22
30 0.23
31 0.26
32 0.34
33 0.34
34 0.34
35 0.34
36 0.27
37 0.29
38 0.3
39 0.27
40 0.21
41 0.22
42 0.25
43 0.25
44 0.26
45 0.22
46 0.18
47 0.2
48 0.19
49 0.15
50 0.16
51 0.16
52 0.16
53 0.17
54 0.17
55 0.15
56 0.15
57 0.22
58 0.17
59 0.19
60 0.18
61 0.2
62 0.2
63 0.21
64 0.2
65 0.14
66 0.17
67 0.16
68 0.19
69 0.16
70 0.15
71 0.14
72 0.14
73 0.14
74 0.09
75 0.08
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.1
86 0.11
87 0.18
88 0.21
89 0.21
90 0.25
91 0.28
92 0.35
93 0.42
94 0.5
95 0.52
96 0.55
97 0.64
98 0.67
99 0.71
100 0.68
101 0.65
102 0.65
103 0.6
104 0.59
105 0.52
106 0.46
107 0.39
108 0.34
109 0.28
110 0.22
111 0.19
112 0.14
113 0.12
114 0.13
115 0.15
116 0.14
117 0.12
118 0.12
119 0.11
120 0.11
121 0.12
122 0.09
123 0.09
124 0.08
125 0.09
126 0.08
127 0.1
128 0.13
129 0.12
130 0.12
131 0.15
132 0.17
133 0.17
134 0.2
135 0.22
136 0.24
137 0.3
138 0.39
139 0.45
140 0.51
141 0.57
142 0.65
143 0.72
144 0.78
145 0.82
146 0.82
147 0.84
148 0.82
149 0.86
150 0.84
151 0.85
152 0.86
153 0.86
154 0.88
155 0.89
156 0.89
157 0.88
158 0.89
159 0.85
160 0.83
161 0.81
162 0.78
163 0.77
164 0.76
165 0.72
166 0.63
167 0.55
168 0.48
169 0.38
170 0.3
171 0.2
172 0.15
173 0.1
174 0.11
175 0.1
176 0.09
177 0.12