Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167V5U9

Protein Details
Accession A0A167V5U9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKPSSRSSCKSRSFRIPKISYKSSKHydrophilic
78-105LVVRPLVRRRRSNIRRPQQKLRRCSPLVHydrophilic
NLS Segment(s)
PositionSequence
86-89RRRS
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR020818  Chaperonin_GroES  
IPR037124  Chaperonin_GroES_sf  
IPR018369  Chaprnonin_Cpn10_CS  
IPR011032  GroES-like_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0044183  F:protein folding chaperone  
Pfam View protein in Pfam  
PF00166  Cpn10  
PROSITE View protein in PROSITE  
PS00681  CHAPERONINS_CPN10  
CDD cd00320  cpn10  
Amino Acid Sequences MKPSSRSSCKSRSFRIPKISYKSSKYLYEEEIIVPMAAGERQLAVSCDIKVASNGSSHKSVWMRRPSFDSDDDACSALVVRPLVRRRRSNIRRPQQKLRRCSPLVPSLNPAVVDGPSEDESGTDNDEGDVLSTSWSDSEEYGSTPSSPALSLVHPTASQLSTYANPNSSRVSINMSAANLPSFILEAIANPKPLKSGPRGDLRCYACNSPAKRDVIRCDYSGSYGRYYRCCDNHNYRLFLAYDDVVGNLPDNPCCRCGESMKLQPQPHAPSYGGNWRAALRNIKSLVPLLDRVLVQRIKPEAKTASGIFLPESSVKDLNEAKVLAVGPGMLNKDGKRIEMSVKEGDKVLIPQYGGSPVKVGEEEYSLFRDSDILAKLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.82
4 0.82
5 0.82
6 0.83
7 0.8
8 0.77
9 0.75
10 0.69
11 0.68
12 0.63
13 0.59
14 0.53
15 0.48
16 0.44
17 0.37
18 0.33
19 0.27
20 0.21
21 0.16
22 0.12
23 0.09
24 0.08
25 0.07
26 0.06
27 0.06
28 0.07
29 0.08
30 0.09
31 0.11
32 0.13
33 0.13
34 0.14
35 0.14
36 0.14
37 0.14
38 0.15
39 0.13
40 0.16
41 0.18
42 0.21
43 0.23
44 0.23
45 0.29
46 0.33
47 0.37
48 0.42
49 0.5
50 0.5
51 0.5
52 0.55
53 0.55
54 0.54
55 0.51
56 0.47
57 0.39
58 0.4
59 0.38
60 0.33
61 0.26
62 0.21
63 0.19
64 0.14
65 0.13
66 0.11
67 0.12
68 0.18
69 0.27
70 0.36
71 0.43
72 0.49
73 0.53
74 0.64
75 0.72
76 0.76
77 0.79
78 0.81
79 0.84
80 0.84
81 0.89
82 0.88
83 0.87
84 0.85
85 0.82
86 0.81
87 0.73
88 0.71
89 0.66
90 0.66
91 0.62
92 0.55
93 0.51
94 0.43
95 0.4
96 0.36
97 0.29
98 0.2
99 0.14
100 0.13
101 0.1
102 0.1
103 0.1
104 0.11
105 0.1
106 0.09
107 0.11
108 0.11
109 0.12
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.08
128 0.09
129 0.1
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.09
140 0.1
141 0.09
142 0.1
143 0.11
144 0.09
145 0.09
146 0.08
147 0.09
148 0.1
149 0.12
150 0.13
151 0.14
152 0.14
153 0.16
154 0.17
155 0.17
156 0.16
157 0.14
158 0.18
159 0.16
160 0.17
161 0.17
162 0.16
163 0.15
164 0.14
165 0.13
166 0.08
167 0.07
168 0.06
169 0.05
170 0.04
171 0.04
172 0.04
173 0.04
174 0.08
175 0.09
176 0.1
177 0.1
178 0.1
179 0.11
180 0.12
181 0.15
182 0.16
183 0.21
184 0.25
185 0.34
186 0.36
187 0.38
188 0.45
189 0.45
190 0.44
191 0.4
192 0.37
193 0.32
194 0.36
195 0.35
196 0.33
197 0.35
198 0.35
199 0.36
200 0.38
201 0.39
202 0.4
203 0.4
204 0.35
205 0.32
206 0.29
207 0.29
208 0.3
209 0.26
210 0.22
211 0.23
212 0.25
213 0.25
214 0.29
215 0.32
216 0.31
217 0.32
218 0.37
219 0.42
220 0.5
221 0.51
222 0.51
223 0.45
224 0.44
225 0.41
226 0.34
227 0.26
228 0.17
229 0.13
230 0.1
231 0.1
232 0.08
233 0.08
234 0.07
235 0.08
236 0.08
237 0.09
238 0.11
239 0.12
240 0.13
241 0.15
242 0.16
243 0.17
244 0.2
245 0.25
246 0.31
247 0.39
248 0.46
249 0.52
250 0.5
251 0.51
252 0.54
253 0.52
254 0.46
255 0.4
256 0.32
257 0.27
258 0.29
259 0.35
260 0.32
261 0.27
262 0.26
263 0.24
264 0.27
265 0.29
266 0.33
267 0.27
268 0.31
269 0.32
270 0.32
271 0.31
272 0.3
273 0.29
274 0.24
275 0.23
276 0.18
277 0.19
278 0.18
279 0.18
280 0.24
281 0.23
282 0.2
283 0.24
284 0.29
285 0.3
286 0.3
287 0.35
288 0.31
289 0.31
290 0.34
291 0.3
292 0.28
293 0.24
294 0.24
295 0.19
296 0.17
297 0.16
298 0.15
299 0.16
300 0.16
301 0.18
302 0.17
303 0.21
304 0.24
305 0.23
306 0.24
307 0.22
308 0.19
309 0.19
310 0.2
311 0.15
312 0.12
313 0.11
314 0.08
315 0.11
316 0.13
317 0.11
318 0.14
319 0.15
320 0.22
321 0.22
322 0.24
323 0.24
324 0.25
325 0.3
326 0.33
327 0.37
328 0.38
329 0.39
330 0.39
331 0.36
332 0.34
333 0.29
334 0.26
335 0.24
336 0.19
337 0.17
338 0.17
339 0.18
340 0.25
341 0.24
342 0.22
343 0.21
344 0.18
345 0.21
346 0.2
347 0.2
348 0.14
349 0.16
350 0.17
351 0.19
352 0.21
353 0.2
354 0.19
355 0.18
356 0.18
357 0.16
358 0.19
359 0.21