Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167Z0K0

Protein Details
Accession A0A167Z0K0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
163-184QNKSQRQTKPSRSKSHKQTQDFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 8.5, cyto 8.5, mito 5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MELREILAKVGHAVEDAEEESFDIFCEELPSGNLGFIDSQADEVDVTVNGRDFAIKQSPTILSSSRAGGTTGAVLWKITPLVAEWLSDYGNFLWEEAILSSDSTVAELGCGISGLIPLALAPMVQNCIVTDQEYVHKLLKENLQRNYTCEGSGRDKKGSRLSQNKSQRQTKPSRSKSHKQTQDFLWERTGNITFTPLDWETDFPAELKQVLKSTTTSDTSSRLNDEDGEEDRGFDLLIACDTIYNEALVPSFVQTCAEICRLRPAYNDGLVNPTTTEARNKPTVCVVAQHLRSSDVFDAWCRETMEWFHVWRLRNEETDGALGMGSGSMVHLLVLKAGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.08
14 0.08
15 0.08
16 0.09
17 0.11
18 0.11
19 0.11
20 0.11
21 0.1
22 0.1
23 0.09
24 0.11
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.13
41 0.2
42 0.2
43 0.2
44 0.23
45 0.24
46 0.25
47 0.26
48 0.23
49 0.18
50 0.2
51 0.21
52 0.18
53 0.18
54 0.17
55 0.15
56 0.14
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.08
63 0.08
64 0.08
65 0.07
66 0.06
67 0.06
68 0.1
69 0.11
70 0.11
71 0.11
72 0.12
73 0.12
74 0.11
75 0.12
76 0.08
77 0.1
78 0.09
79 0.09
80 0.08
81 0.08
82 0.08
83 0.07
84 0.08
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.05
111 0.05
112 0.05
113 0.05
114 0.07
115 0.07
116 0.08
117 0.08
118 0.08
119 0.11
120 0.12
121 0.14
122 0.14
123 0.15
124 0.15
125 0.19
126 0.24
127 0.3
128 0.35
129 0.38
130 0.42
131 0.41
132 0.43
133 0.43
134 0.37
135 0.29
136 0.24
137 0.23
138 0.25
139 0.31
140 0.31
141 0.33
142 0.34
143 0.37
144 0.43
145 0.46
146 0.47
147 0.5
148 0.52
149 0.57
150 0.66
151 0.7
152 0.69
153 0.71
154 0.68
155 0.66
156 0.7
157 0.71
158 0.72
159 0.73
160 0.76
161 0.76
162 0.8
163 0.82
164 0.82
165 0.81
166 0.73
167 0.69
168 0.62
169 0.64
170 0.58
171 0.49
172 0.43
173 0.35
174 0.31
175 0.29
176 0.27
177 0.17
178 0.14
179 0.14
180 0.1
181 0.1
182 0.14
183 0.11
184 0.12
185 0.12
186 0.12
187 0.12
188 0.12
189 0.12
190 0.09
191 0.09
192 0.08
193 0.09
194 0.09
195 0.09
196 0.1
197 0.11
198 0.11
199 0.12
200 0.14
201 0.17
202 0.18
203 0.19
204 0.19
205 0.2
206 0.21
207 0.22
208 0.2
209 0.17
210 0.16
211 0.15
212 0.15
213 0.15
214 0.15
215 0.19
216 0.17
217 0.16
218 0.16
219 0.15
220 0.13
221 0.11
222 0.1
223 0.05
224 0.06
225 0.05
226 0.05
227 0.06
228 0.06
229 0.07
230 0.07
231 0.06
232 0.06
233 0.06
234 0.07
235 0.06
236 0.07
237 0.06
238 0.07
239 0.07
240 0.07
241 0.07
242 0.08
243 0.11
244 0.15
245 0.15
246 0.14
247 0.24
248 0.26
249 0.27
250 0.28
251 0.31
252 0.32
253 0.35
254 0.36
255 0.27
256 0.29
257 0.28
258 0.26
259 0.21
260 0.17
261 0.15
262 0.15
263 0.21
264 0.2
265 0.25
266 0.32
267 0.33
268 0.34
269 0.37
270 0.39
271 0.33
272 0.33
273 0.34
274 0.35
275 0.37
276 0.37
277 0.33
278 0.32
279 0.31
280 0.32
281 0.27
282 0.21
283 0.19
284 0.18
285 0.22
286 0.22
287 0.25
288 0.23
289 0.22
290 0.23
291 0.24
292 0.27
293 0.26
294 0.26
295 0.29
296 0.32
297 0.35
298 0.36
299 0.4
300 0.4
301 0.39
302 0.41
303 0.38
304 0.35
305 0.33
306 0.29
307 0.22
308 0.18
309 0.14
310 0.11
311 0.08
312 0.06
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.06
319 0.06