Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168AYT5

Protein Details
Accession A0A168AYT5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-43QEEKKDDKDKKKGGKILRGRRRNYBasic
NLS Segment(s)
PositionSequence
22-41EKKDDKDKKKGGKILRGRRR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 7, cyto_pero 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045297  Complex1_LYR_LYRM4  
Gene Ontology GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20264  Complex1_LYR_LYRM4  
Amino Acid Sequences MTNEEEEEEKSKKNRLGLLQEEKKDDKDKKKGGKILRGRRRNYSPYTTATATATATALPSPTTPISIQQPKMSLATASPSPATAYHARSLLRSLLRQSNHFSAYNFREYAKRRTRDAFRENSHVSDPRQLQELLQYGLQELRMMRRQTLISQFYQLEKLVVEGGDPEGKMRIENRGGENSGALREGKEVEMERLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.52
4 0.56
5 0.64
6 0.66
7 0.66
8 0.67
9 0.63
10 0.59
11 0.59
12 0.58
13 0.57
14 0.59
15 0.65
16 0.69
17 0.76
18 0.79
19 0.79
20 0.81
21 0.82
22 0.82
23 0.83
24 0.83
25 0.78
26 0.79
27 0.79
28 0.76
29 0.73
30 0.69
31 0.63
32 0.58
33 0.58
34 0.51
35 0.43
36 0.36
37 0.3
38 0.23
39 0.19
40 0.14
41 0.09
42 0.08
43 0.07
44 0.07
45 0.06
46 0.06
47 0.08
48 0.08
49 0.1
50 0.1
51 0.13
52 0.2
53 0.26
54 0.28
55 0.27
56 0.28
57 0.27
58 0.28
59 0.25
60 0.18
61 0.12
62 0.13
63 0.11
64 0.11
65 0.09
66 0.09
67 0.09
68 0.09
69 0.13
70 0.13
71 0.15
72 0.16
73 0.18
74 0.18
75 0.18
76 0.19
77 0.19
78 0.17
79 0.16
80 0.18
81 0.21
82 0.22
83 0.24
84 0.26
85 0.25
86 0.26
87 0.26
88 0.23
89 0.23
90 0.25
91 0.26
92 0.23
93 0.21
94 0.24
95 0.27
96 0.37
97 0.41
98 0.41
99 0.42
100 0.48
101 0.54
102 0.57
103 0.61
104 0.59
105 0.54
106 0.58
107 0.56
108 0.51
109 0.47
110 0.41
111 0.35
112 0.33
113 0.32
114 0.25
115 0.27
116 0.25
117 0.22
118 0.23
119 0.24
120 0.18
121 0.17
122 0.16
123 0.13
124 0.14
125 0.14
126 0.11
127 0.09
128 0.13
129 0.19
130 0.2
131 0.21
132 0.23
133 0.25
134 0.28
135 0.36
136 0.34
137 0.29
138 0.32
139 0.32
140 0.3
141 0.31
142 0.27
143 0.19
144 0.15
145 0.14
146 0.12
147 0.1
148 0.09
149 0.07
150 0.09
151 0.11
152 0.11
153 0.11
154 0.12
155 0.12
156 0.14
157 0.14
158 0.2
159 0.22
160 0.27
161 0.31
162 0.35
163 0.36
164 0.35
165 0.35
166 0.3
167 0.26
168 0.23
169 0.19
170 0.14
171 0.14
172 0.15
173 0.14
174 0.17
175 0.18