Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q1K5K2

Protein Details
Accession Q1K5K2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-68ATTTKTKKSKQQTIHYPFWFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, cyto 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015297  F:antiporter activity  
GO:0015140  F:malate transmembrane transporter activity  
GO:0015131  F:oxaloacetate transmembrane transporter activity  
GO:0015141  F:succinate transmembrane transporter activity  
GO:0015116  F:sulfate transmembrane transporter activity  
GO:0015117  F:thiosulfate transmembrane transporter activity  
GO:0071423  P:malate transmembrane transport  
GO:0015729  P:oxaloacetate transport  
GO:0035435  P:phosphate ion transmembrane transport  
GO:0071422  P:succinate transmembrane transport  
GO:0008272  P:sulfate transport  
GO:0015709  P:thiosulfate transport  
KEGG ncr:NCU01514  -  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MQAVTTGLEGPSSSPSDSKQTAAASVTKPAAQAIMDKQTMTSDKPVVAATTTKTKKSKQQTIHYPFWFGGSASSMAATVTHPLDLVKVRLQMRTGDAPKTMSGTVLHIIRHNGITGLYNGLSASLLRQITYSTTRFGIYEELKTRFTTKDHPASFPVLIAMATVSGVAGGLVGNVADVLNVRMQHDAALPPAQRRNYAHAIDGLARMTREEGFRSWFRGVWPNSARAAAMTASQLASYDVFKRILIRHTPLEDNLATHFSASFLAGVAAATVTSPIDVVKTRVMSASGKSSIGQVLGSLYAQEGVRWMFKGWVPSFLRLGPQTICTFIFLEGHRKMYKKVKGIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.24
4 0.26
5 0.26
6 0.26
7 0.25
8 0.26
9 0.27
10 0.3
11 0.24
12 0.27
13 0.28
14 0.25
15 0.24
16 0.22
17 0.2
18 0.16
19 0.18
20 0.19
21 0.24
22 0.24
23 0.24
24 0.24
25 0.26
26 0.28
27 0.26
28 0.26
29 0.22
30 0.21
31 0.23
32 0.23
33 0.2
34 0.19
35 0.19
36 0.17
37 0.25
38 0.28
39 0.33
40 0.38
41 0.42
42 0.5
43 0.58
44 0.65
45 0.64
46 0.72
47 0.76
48 0.79
49 0.84
50 0.76
51 0.68
52 0.58
53 0.5
54 0.4
55 0.29
56 0.22
57 0.15
58 0.14
59 0.11
60 0.11
61 0.09
62 0.08
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.1
71 0.11
72 0.13
73 0.14
74 0.2
75 0.21
76 0.23
77 0.24
78 0.24
79 0.27
80 0.33
81 0.32
82 0.29
83 0.28
84 0.28
85 0.27
86 0.28
87 0.23
88 0.16
89 0.14
90 0.13
91 0.15
92 0.15
93 0.16
94 0.15
95 0.16
96 0.16
97 0.16
98 0.14
99 0.12
100 0.1
101 0.11
102 0.1
103 0.1
104 0.09
105 0.08
106 0.08
107 0.08
108 0.07
109 0.06
110 0.06
111 0.08
112 0.08
113 0.08
114 0.09
115 0.09
116 0.12
117 0.16
118 0.16
119 0.14
120 0.15
121 0.15
122 0.15
123 0.15
124 0.18
125 0.15
126 0.19
127 0.22
128 0.23
129 0.24
130 0.25
131 0.26
132 0.23
133 0.23
134 0.25
135 0.28
136 0.34
137 0.35
138 0.36
139 0.36
140 0.37
141 0.35
142 0.28
143 0.22
144 0.13
145 0.1
146 0.08
147 0.06
148 0.03
149 0.03
150 0.03
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.05
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.12
176 0.12
177 0.14
178 0.19
179 0.19
180 0.21
181 0.22
182 0.28
183 0.3
184 0.3
185 0.28
186 0.25
187 0.26
188 0.24
189 0.23
190 0.17
191 0.11
192 0.1
193 0.09
194 0.09
195 0.09
196 0.09
197 0.1
198 0.11
199 0.15
200 0.17
201 0.2
202 0.2
203 0.2
204 0.21
205 0.28
206 0.28
207 0.32
208 0.34
209 0.33
210 0.33
211 0.32
212 0.3
213 0.21
214 0.21
215 0.12
216 0.11
217 0.08
218 0.08
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.08
225 0.09
226 0.11
227 0.12
228 0.12
229 0.15
230 0.17
231 0.22
232 0.26
233 0.28
234 0.3
235 0.33
236 0.35
237 0.32
238 0.34
239 0.28
240 0.25
241 0.22
242 0.19
243 0.16
244 0.14
245 0.13
246 0.09
247 0.09
248 0.09
249 0.07
250 0.05
251 0.06
252 0.05
253 0.05
254 0.05
255 0.04
256 0.04
257 0.03
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.06
264 0.07
265 0.09
266 0.13
267 0.14
268 0.15
269 0.15
270 0.18
271 0.18
272 0.19
273 0.24
274 0.22
275 0.21
276 0.21
277 0.21
278 0.2
279 0.19
280 0.16
281 0.1
282 0.09
283 0.09
284 0.09
285 0.08
286 0.07
287 0.09
288 0.09
289 0.08
290 0.09
291 0.1
292 0.12
293 0.13
294 0.14
295 0.15
296 0.17
297 0.26
298 0.25
299 0.33
300 0.35
301 0.37
302 0.39
303 0.36
304 0.4
305 0.32
306 0.35
307 0.27
308 0.28
309 0.26
310 0.26
311 0.26
312 0.22
313 0.22
314 0.2
315 0.23
316 0.2
317 0.27
318 0.27
319 0.33
320 0.35
321 0.36
322 0.42
323 0.48
324 0.54
325 0.55