Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168DXX8

Protein Details
Accession A0A168DXX8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-40SVPATPKKTPNRVTKKTPKSTKKAENWKSHydrophilic
NLS Segment(s)
PositionSequence
26-30KKTPK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVIADHHAGDESVPATPKKTPNRVTKKTPKSTKKAENWKSDVSAMLASDDELSSSKKELLKKEVDEALEEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.17
4 0.25
5 0.32
6 0.41
7 0.48
8 0.57
9 0.67
10 0.72
11 0.78
12 0.81
13 0.82
14 0.83
15 0.85
16 0.83
17 0.8
18 0.82
19 0.82
20 0.8
21 0.81
22 0.79
23 0.76
24 0.72
25 0.66
26 0.59
27 0.49
28 0.41
29 0.31
30 0.23
31 0.15
32 0.11
33 0.09
34 0.07
35 0.07
36 0.07
37 0.06
38 0.06
39 0.08
40 0.08
41 0.1
42 0.14
43 0.17
44 0.23
45 0.28
46 0.34
47 0.41
48 0.42
49 0.47
50 0.48
51 0.45