Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167V3Q1

Protein Details
Accession A0A167V3Q1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
132-160ANKRTSRRTGGKNKTKGKNKKKGQHGVLHBasic
233-256FDFPGLPEKKRREEEKKQGESPMKBasic
NLS Segment(s)
PositionSequence
133-155NKRTSRRTGGKNKTKGKNKKKGQ
241-245KKRRE
Subcellular Location(s) extr 20, golg 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007653  SPC3  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF04573  SPC22  
Amino Acid Sequences MHSISNRIQAVFGFFTSVAIFLGVLIALSTSLFPADVKTNVELAGVKVLKGRPTYYSPRREEYAQIKFDLDADLSSLFNWNTKQVFLYVLVSYPSSIPGSNATSEAIIWDYIIPAKPSPYSLTSLKEKYLPANKRTSRRTGGKNKTKGKNKKKGQHGVLHLRNQRAKYHLTDITHSLANRQNASLVVGWNVQPWVGPLMWNSGSKTASNVGDMRIFNLGFVTGGSGGAGSKKFDFPGLPEKKRREEEKKQGESPMKESASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.1
6 0.08
7 0.08
8 0.05
9 0.06
10 0.05
11 0.04
12 0.04
13 0.03
14 0.03
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.07
22 0.1
23 0.12
24 0.14
25 0.15
26 0.16
27 0.16
28 0.17
29 0.15
30 0.13
31 0.19
32 0.17
33 0.16
34 0.19
35 0.21
36 0.24
37 0.26
38 0.26
39 0.23
40 0.3
41 0.4
42 0.45
43 0.53
44 0.53
45 0.56
46 0.57
47 0.55
48 0.56
49 0.54
50 0.54
51 0.46
52 0.43
53 0.39
54 0.36
55 0.34
56 0.28
57 0.19
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.09
64 0.08
65 0.09
66 0.1
67 0.12
68 0.12
69 0.13
70 0.13
71 0.12
72 0.13
73 0.13
74 0.14
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.11
87 0.11
88 0.12
89 0.11
90 0.1
91 0.1
92 0.09
93 0.07
94 0.06
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.09
105 0.11
106 0.12
107 0.15
108 0.16
109 0.2
110 0.23
111 0.24
112 0.24
113 0.24
114 0.23
115 0.24
116 0.31
117 0.33
118 0.32
119 0.41
120 0.45
121 0.5
122 0.54
123 0.55
124 0.53
125 0.55
126 0.61
127 0.62
128 0.68
129 0.7
130 0.75
131 0.78
132 0.8
133 0.84
134 0.85
135 0.85
136 0.85
137 0.85
138 0.84
139 0.85
140 0.85
141 0.81
142 0.78
143 0.75
144 0.75
145 0.72
146 0.72
147 0.65
148 0.61
149 0.59
150 0.53
151 0.47
152 0.4
153 0.37
154 0.32
155 0.34
156 0.32
157 0.3
158 0.3
159 0.3
160 0.3
161 0.29
162 0.25
163 0.23
164 0.24
165 0.25
166 0.23
167 0.21
168 0.19
169 0.17
170 0.2
171 0.17
172 0.13
173 0.11
174 0.12
175 0.12
176 0.12
177 0.11
178 0.09
179 0.08
180 0.08
181 0.09
182 0.08
183 0.09
184 0.08
185 0.14
186 0.16
187 0.18
188 0.18
189 0.19
190 0.2
191 0.2
192 0.21
193 0.2
194 0.18
195 0.2
196 0.2
197 0.18
198 0.22
199 0.22
200 0.21
201 0.2
202 0.19
203 0.16
204 0.15
205 0.14
206 0.09
207 0.09
208 0.09
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.09
215 0.09
216 0.1
217 0.12
218 0.14
219 0.14
220 0.16
221 0.17
222 0.19
223 0.3
224 0.38
225 0.44
226 0.52
227 0.58
228 0.66
229 0.73
230 0.78
231 0.78
232 0.79
233 0.82
234 0.84
235 0.85
236 0.8
237 0.81
238 0.79
239 0.74
240 0.67
241 0.65