Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VGQ5

Protein Details
Accession A0A167VGQ5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-136IVRETMKRRKASKARKSRRKYRKLEEEKKVKEGGBasic
NLS Segment(s)
PositionSequence
108-133MKRRKASKARKSRRKYRKLEEEKKVK
Subcellular Location(s) mito 18.5, mito_nucl 14, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MPLFPPLPLSIFRPPLLALQLPLRLPIRSRSLSSTPCLLKKQMPPRPKLDPADIDGSYLKGTGPGVVKCQETRSRSQNQKIAMEILAGKVELLEKGDQSRAAIVRETMKRRKASKARKSRRKYRKLEEEKKVKEGGEEEEEEDMEEEVVIEEKEEVVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.3
4 0.26
5 0.2
6 0.2
7 0.24
8 0.22
9 0.25
10 0.24
11 0.21
12 0.22
13 0.26
14 0.29
15 0.28
16 0.31
17 0.34
18 0.38
19 0.4
20 0.41
21 0.43
22 0.39
23 0.41
24 0.41
25 0.38
26 0.38
27 0.43
28 0.51
29 0.53
30 0.57
31 0.58
32 0.61
33 0.65
34 0.66
35 0.62
36 0.56
37 0.51
38 0.46
39 0.46
40 0.4
41 0.34
42 0.27
43 0.23
44 0.17
45 0.15
46 0.11
47 0.06
48 0.06
49 0.08
50 0.1
51 0.1
52 0.13
53 0.15
54 0.16
55 0.16
56 0.2
57 0.24
58 0.24
59 0.29
60 0.32
61 0.39
62 0.45
63 0.51
64 0.5
65 0.47
66 0.45
67 0.41
68 0.36
69 0.27
70 0.21
71 0.15
72 0.11
73 0.08
74 0.07
75 0.06
76 0.05
77 0.05
78 0.04
79 0.06
80 0.06
81 0.06
82 0.08
83 0.09
84 0.09
85 0.09
86 0.11
87 0.11
88 0.12
89 0.12
90 0.12
91 0.18
92 0.24
93 0.31
94 0.36
95 0.41
96 0.47
97 0.5
98 0.59
99 0.63
100 0.68
101 0.71
102 0.76
103 0.8
104 0.85
105 0.91
106 0.92
107 0.93
108 0.92
109 0.91
110 0.9
111 0.91
112 0.91
113 0.92
114 0.91
115 0.91
116 0.85
117 0.8
118 0.72
119 0.61
120 0.52
121 0.44
122 0.39
123 0.33
124 0.3
125 0.26
126 0.24
127 0.24
128 0.22
129 0.2
130 0.15
131 0.09
132 0.08
133 0.06
134 0.06
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06