Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167WC70

Protein Details
Accession A0A167WC70   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
137-158GSLRGRDQEKRARRRWSRGCARBasic
NLS Segment(s)
PositionSequence
146-151KRARRR
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011057  Mss4-like_sf  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MATTAGKSTQQQQTTPASPAAVTHLHGSCSCGRNQYVVSIPLEQREYAAVYFDNGSDGRLTNGAPITAFLRIPLTWYSSSTYAYTPQESPSSIRRVFAPHDANPYARRTFCGYCGTPLTYWTEQPDGEGGFMSVTVGSLRGRDQEKRARRRWSRGCAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.36
4 0.28
5 0.25
6 0.24
7 0.24
8 0.18
9 0.16
10 0.18
11 0.17
12 0.18
13 0.19
14 0.21
15 0.23
16 0.24
17 0.25
18 0.25
19 0.25
20 0.26
21 0.26
22 0.26
23 0.24
24 0.24
25 0.24
26 0.24
27 0.24
28 0.24
29 0.25
30 0.21
31 0.18
32 0.16
33 0.16
34 0.11
35 0.12
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.06
57 0.07
58 0.07
59 0.09
60 0.09
61 0.11
62 0.11
63 0.12
64 0.14
65 0.13
66 0.15
67 0.14
68 0.14
69 0.14
70 0.14
71 0.15
72 0.14
73 0.15
74 0.15
75 0.15
76 0.16
77 0.18
78 0.23
79 0.22
80 0.22
81 0.21
82 0.23
83 0.25
84 0.3
85 0.3
86 0.26
87 0.32
88 0.33
89 0.33
90 0.33
91 0.35
92 0.31
93 0.26
94 0.26
95 0.25
96 0.25
97 0.27
98 0.31
99 0.28
100 0.28
101 0.31
102 0.31
103 0.26
104 0.25
105 0.28
106 0.23
107 0.23
108 0.23
109 0.22
110 0.2
111 0.2
112 0.21
113 0.15
114 0.14
115 0.13
116 0.1
117 0.07
118 0.07
119 0.07
120 0.05
121 0.05
122 0.04
123 0.06
124 0.06
125 0.07
126 0.08
127 0.14
128 0.18
129 0.23
130 0.32
131 0.41
132 0.51
133 0.61
134 0.68
135 0.74
136 0.79
137 0.85
138 0.87