Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162IDI9

Protein Details
Accession A0A162IDI9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
180-205IEAEAKKERQHQHQHQHEKHQHEKGQBasic
NLS Segment(s)
Subcellular Location(s) extr 10, E.R. 7, plas 3, mito 2, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013248  Psh3/Shr3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08229  SHR3_chaperone  
Amino Acid Sequences MARTTFATFLIVCPTCFFLGIVFSLLPYDYPLLWSPEPTPASYYDFAEAHLKFLHASPPLISRMLHTTIAVTLIGFLIKLYKPSESNLLFDGASLVLFMCGVVVYVANIVKGLRTATAGAYGTGHVTAEEAASGAEPLLSREDSLKVLSASNTILALVLVGVLVLQAGQWYADRKEQQEIEAEAKKERQHQHQHQHEKHQHEKGQQHEGSAAQKKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.19
4 0.18
5 0.11
6 0.12
7 0.12
8 0.13
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.08
15 0.09
16 0.07
17 0.1
18 0.12
19 0.17
20 0.17
21 0.19
22 0.19
23 0.25
24 0.26
25 0.24
26 0.24
27 0.21
28 0.26
29 0.26
30 0.26
31 0.21
32 0.2
33 0.21
34 0.24
35 0.22
36 0.19
37 0.18
38 0.17
39 0.14
40 0.15
41 0.18
42 0.14
43 0.15
44 0.14
45 0.17
46 0.18
47 0.19
48 0.18
49 0.15
50 0.18
51 0.2
52 0.19
53 0.16
54 0.15
55 0.14
56 0.15
57 0.13
58 0.08
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.06
65 0.06
66 0.08
67 0.09
68 0.11
69 0.12
70 0.13
71 0.2
72 0.19
73 0.2
74 0.19
75 0.19
76 0.17
77 0.16
78 0.15
79 0.08
80 0.07
81 0.06
82 0.05
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.07
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.04
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.06
126 0.06
127 0.07
128 0.08
129 0.1
130 0.1
131 0.11
132 0.11
133 0.1
134 0.11
135 0.11
136 0.11
137 0.1
138 0.09
139 0.09
140 0.07
141 0.07
142 0.06
143 0.05
144 0.04
145 0.03
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.03
156 0.04
157 0.08
158 0.1
159 0.16
160 0.19
161 0.21
162 0.28
163 0.29
164 0.29
165 0.31
166 0.32
167 0.33
168 0.35
169 0.34
170 0.31
171 0.34
172 0.36
173 0.39
174 0.43
175 0.47
176 0.53
177 0.62
178 0.7
179 0.77
180 0.85
181 0.83
182 0.88
183 0.85
184 0.83
185 0.82
186 0.8
187 0.76
188 0.73
189 0.73
190 0.68
191 0.71
192 0.63
193 0.55
194 0.48
195 0.45
196 0.45
197 0.47