Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K561

Protein Details
Accession Q1K561   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
236-263SVGFLFFKRWWRKKRLLRRRRTIENIGTHydrophilic
NLS Segment(s)
PositionSequence
244-256RWWRKKRLLRRRR
Subcellular Location(s) extr 11, mito 6, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ncr:NCU01607  -  
Amino Acid Sequences MTNIGPLTTTFTPPASCTTNTPQIYQVWKGTASEYIHGPLYTPDSNCFPDGYVANPSYYYNPGSCPQGYTTAPCSRSGLPVTDTEAAGKTQTAVVCCPSGAALTFTCADDTAQALACTTSFPKGAEVLMGVTVVSDGTIGPHTTVSERRGGIGAYGIQVVLGAMSDGGHIQPSEQDNSGIMATATSLPTTPQPTITDDPLATSTSSSSGGGGGVSTGAAIGIGVGSAAVALLAAGSVGFLFFKRWWRKKRLLRRRRTIENIGTLSSSKGDGGDGDGVADLVSIISNPPPVPPKDLQPFFELSGEVSSTVAASECGHQPSRHMSRFSMFKCGTPTTPPPGHPAEAEQAHLSPVWPPSASHQSRSGSPSHHAYSRPVEHPGHQFAELEAEVPIEAASSDMPSSAEPSLTTPSKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.28
5 0.34
6 0.42
7 0.43
8 0.43
9 0.42
10 0.42
11 0.46
12 0.44
13 0.4
14 0.33
15 0.33
16 0.31
17 0.29
18 0.3
19 0.27
20 0.25
21 0.24
22 0.23
23 0.23
24 0.22
25 0.22
26 0.17
27 0.21
28 0.22
29 0.21
30 0.22
31 0.25
32 0.28
33 0.28
34 0.26
35 0.22
36 0.22
37 0.21
38 0.21
39 0.23
40 0.21
41 0.21
42 0.21
43 0.21
44 0.2
45 0.22
46 0.22
47 0.17
48 0.19
49 0.21
50 0.25
51 0.25
52 0.24
53 0.24
54 0.27
55 0.27
56 0.27
57 0.32
58 0.34
59 0.35
60 0.34
61 0.36
62 0.32
63 0.35
64 0.34
65 0.3
66 0.25
67 0.25
68 0.28
69 0.26
70 0.25
71 0.22
72 0.2
73 0.17
74 0.16
75 0.14
76 0.1
77 0.11
78 0.12
79 0.12
80 0.12
81 0.14
82 0.14
83 0.14
84 0.13
85 0.1
86 0.09
87 0.09
88 0.1
89 0.08
90 0.09
91 0.1
92 0.1
93 0.1
94 0.1
95 0.1
96 0.08
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.09
109 0.1
110 0.11
111 0.11
112 0.1
113 0.1
114 0.08
115 0.07
116 0.07
117 0.06
118 0.05
119 0.05
120 0.04
121 0.03
122 0.03
123 0.02
124 0.04
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.09
131 0.12
132 0.14
133 0.17
134 0.17
135 0.18
136 0.18
137 0.18
138 0.16
139 0.14
140 0.12
141 0.08
142 0.08
143 0.07
144 0.06
145 0.06
146 0.05
147 0.04
148 0.03
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.03
155 0.03
156 0.03
157 0.04
158 0.07
159 0.09
160 0.11
161 0.11
162 0.11
163 0.11
164 0.12
165 0.12
166 0.09
167 0.07
168 0.05
169 0.05
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.07
176 0.1
177 0.09
178 0.1
179 0.12
180 0.16
181 0.18
182 0.19
183 0.18
184 0.16
185 0.16
186 0.16
187 0.15
188 0.1
189 0.09
190 0.08
191 0.07
192 0.08
193 0.07
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.04
200 0.03
201 0.03
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.01
209 0.01
210 0.01
211 0.01
212 0.01
213 0.01
214 0.01
215 0.01
216 0.01
217 0.01
218 0.01
219 0.01
220 0.01
221 0.01
222 0.01
223 0.02
224 0.02
225 0.02
226 0.02
227 0.04
228 0.06
229 0.15
230 0.26
231 0.35
232 0.43
233 0.51
234 0.62
235 0.7
236 0.81
237 0.83
238 0.84
239 0.86
240 0.89
241 0.89
242 0.88
243 0.85
244 0.82
245 0.76
246 0.72
247 0.63
248 0.53
249 0.45
250 0.36
251 0.29
252 0.21
253 0.16
254 0.09
255 0.07
256 0.07
257 0.06
258 0.07
259 0.08
260 0.07
261 0.07
262 0.07
263 0.06
264 0.06
265 0.06
266 0.04
267 0.03
268 0.03
269 0.03
270 0.03
271 0.04
272 0.05
273 0.06
274 0.08
275 0.13
276 0.15
277 0.21
278 0.22
279 0.29
280 0.37
281 0.4
282 0.4
283 0.39
284 0.4
285 0.35
286 0.35
287 0.27
288 0.18
289 0.16
290 0.14
291 0.11
292 0.09
293 0.07
294 0.06
295 0.06
296 0.06
297 0.05
298 0.05
299 0.08
300 0.11
301 0.14
302 0.17
303 0.17
304 0.19
305 0.28
306 0.36
307 0.39
308 0.39
309 0.37
310 0.4
311 0.49
312 0.48
313 0.49
314 0.4
315 0.37
316 0.4
317 0.41
318 0.38
319 0.36
320 0.4
321 0.38
322 0.42
323 0.4
324 0.41
325 0.42
326 0.41
327 0.36
328 0.34
329 0.33
330 0.29
331 0.3
332 0.26
333 0.22
334 0.21
335 0.2
336 0.17
337 0.13
338 0.14
339 0.14
340 0.13
341 0.13
342 0.19
343 0.3
344 0.33
345 0.33
346 0.38
347 0.39
348 0.43
349 0.45
350 0.42
351 0.35
352 0.37
353 0.4
354 0.38
355 0.4
356 0.37
357 0.39
358 0.44
359 0.48
360 0.46
361 0.45
362 0.44
363 0.45
364 0.5
365 0.51
366 0.46
367 0.4
368 0.37
369 0.31
370 0.34
371 0.28
372 0.21
373 0.15
374 0.12
375 0.11
376 0.11
377 0.1
378 0.05
379 0.05
380 0.05
381 0.05
382 0.06
383 0.06
384 0.07
385 0.08
386 0.08
387 0.11
388 0.12
389 0.12
390 0.11
391 0.14
392 0.21