Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168DUF1

Protein Details
Accession A0A168DUF1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-133AASPVEKASRQQRKQRKNRAKKFRGTAKTKGPKKSKNHydrophilic
NLS Segment(s)
PositionSequence
102-133EKASRQQRKQRKNRAKKFRGTAKTKGPKKSKN
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADVPVTLRTRKFIRNPLLGRKQMVVDILHPNQANISKDDLRGKLAELYKAGKDQVSVFGLRTHYGGGKTTGFALIYDSAEALKKFEPRYRLVRIGAASPVEKASRQQRKQRKNRAKKFRGTAKTKGPKKSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.26
15 0.25
16 0.27
17 0.26
18 0.24
19 0.24
20 0.26
21 0.25
22 0.19
23 0.23
24 0.21
25 0.24
26 0.29
27 0.27
28 0.26
29 0.24
30 0.24
31 0.24
32 0.24
33 0.22
34 0.19
35 0.21
36 0.2
37 0.2
38 0.2
39 0.14
40 0.13
41 0.12
42 0.14
43 0.13
44 0.13
45 0.12
46 0.14
47 0.14
48 0.14
49 0.13
50 0.11
51 0.1
52 0.1
53 0.11
54 0.1
55 0.1
56 0.09
57 0.1
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.08
68 0.08
69 0.08
70 0.09
71 0.13
72 0.15
73 0.19
74 0.23
75 0.26
76 0.33
77 0.38
78 0.41
79 0.38
80 0.4
81 0.37
82 0.35
83 0.32
84 0.27
85 0.21
86 0.17
87 0.18
88 0.15
89 0.14
90 0.17
91 0.26
92 0.35
93 0.42
94 0.52
95 0.61
96 0.71
97 0.82
98 0.89
99 0.9
100 0.91
101 0.94
102 0.95
103 0.94
104 0.93
105 0.92
106 0.91
107 0.9
108 0.86
109 0.84
110 0.84
111 0.84
112 0.82
113 0.82