Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168CY29

Protein Details
Accession A0A168CY29    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
251-286GKEHYKERVEKPKKSSNKKAKERQNEKIKKLHKEFVBasic
NLS Segment(s)
PositionSequence
256-282KERVEKPKKSSNKKAKERQNEKIKKLH
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
Amino Acid Sequences MVAFRVNSVPASLRATQPEEDNDEYGSGSFIFATQQNDITAEVGNGREDDEDPQAKKRKYYTVAGNKDEYETAQSHERFIRRALRWHYFFTFSNDKIRAFIHRTFPDTKEDYETGDSYERALRGATREWKYETLKRMKNFVAREMRNQETAPGLGLACIDAYDHLHRYFTSTFDEDNFYEVFYWLKGVMDLERSSELGRWYAKEIFSNLATKCKIYLSKVERGDKDATSYWDEIKLFWASQGTNEKLAGVGKEHYKERVEKPKKSSNKKAKERQNEKIKKLHKEFVVSDRPAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.32
5 0.33
6 0.34
7 0.34
8 0.32
9 0.28
10 0.25
11 0.23
12 0.2
13 0.17
14 0.1
15 0.08
16 0.07
17 0.06
18 0.08
19 0.1
20 0.13
21 0.14
22 0.15
23 0.15
24 0.16
25 0.17
26 0.15
27 0.13
28 0.1
29 0.1
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.1
36 0.13
37 0.17
38 0.22
39 0.23
40 0.31
41 0.39
42 0.4
43 0.43
44 0.46
45 0.49
46 0.48
47 0.54
48 0.57
49 0.59
50 0.65
51 0.65
52 0.63
53 0.54
54 0.51
55 0.44
56 0.33
57 0.26
58 0.19
59 0.17
60 0.22
61 0.22
62 0.23
63 0.27
64 0.28
65 0.26
66 0.29
67 0.36
68 0.32
69 0.4
70 0.44
71 0.48
72 0.5
73 0.53
74 0.51
75 0.46
76 0.44
77 0.43
78 0.42
79 0.35
80 0.39
81 0.36
82 0.33
83 0.31
84 0.3
85 0.29
86 0.27
87 0.31
88 0.32
89 0.33
90 0.37
91 0.39
92 0.4
93 0.41
94 0.38
95 0.35
96 0.31
97 0.29
98 0.27
99 0.25
100 0.24
101 0.19
102 0.18
103 0.17
104 0.13
105 0.15
106 0.13
107 0.11
108 0.11
109 0.1
110 0.11
111 0.15
112 0.22
113 0.22
114 0.25
115 0.27
116 0.31
117 0.35
118 0.37
119 0.41
120 0.42
121 0.46
122 0.45
123 0.47
124 0.46
125 0.47
126 0.44
127 0.44
128 0.44
129 0.4
130 0.44
131 0.45
132 0.43
133 0.39
134 0.37
135 0.3
136 0.21
137 0.2
138 0.14
139 0.09
140 0.07
141 0.06
142 0.06
143 0.05
144 0.04
145 0.03
146 0.03
147 0.03
148 0.05
149 0.06
150 0.08
151 0.08
152 0.09
153 0.09
154 0.13
155 0.13
156 0.13
157 0.15
158 0.15
159 0.15
160 0.16
161 0.19
162 0.15
163 0.16
164 0.15
165 0.11
166 0.11
167 0.11
168 0.1
169 0.07
170 0.07
171 0.05
172 0.06
173 0.06
174 0.06
175 0.07
176 0.09
177 0.1
178 0.1
179 0.11
180 0.12
181 0.12
182 0.13
183 0.13
184 0.13
185 0.14
186 0.13
187 0.16
188 0.19
189 0.19
190 0.19
191 0.2
192 0.2
193 0.21
194 0.24
195 0.21
196 0.24
197 0.24
198 0.22
199 0.22
200 0.23
201 0.24
202 0.22
203 0.31
204 0.31
205 0.39
206 0.46
207 0.52
208 0.49
209 0.51
210 0.52
211 0.43
212 0.41
213 0.35
214 0.32
215 0.29
216 0.29
217 0.25
218 0.26
219 0.26
220 0.22
221 0.22
222 0.21
223 0.16
224 0.16
225 0.17
226 0.13
227 0.19
228 0.26
229 0.25
230 0.25
231 0.25
232 0.24
233 0.23
234 0.24
235 0.2
236 0.14
237 0.16
238 0.19
239 0.23
240 0.25
241 0.29
242 0.32
243 0.37
244 0.44
245 0.52
246 0.56
247 0.6
248 0.66
249 0.73
250 0.79
251 0.83
252 0.85
253 0.85
254 0.87
255 0.89
256 0.91
257 0.92
258 0.93
259 0.92
260 0.91
261 0.91
262 0.9
263 0.86
264 0.86
265 0.83
266 0.83
267 0.81
268 0.78
269 0.72
270 0.7
271 0.68
272 0.68
273 0.69