Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VBZ4

Protein Details
Accession A0A167VBZ4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-107AESWQPAKRHFKNPGKEQGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11cyto 11cyto_mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR046451  HgmA_C  
IPR005708  Homogentis_dOase  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Gene Ontology GO:0004411  F:homogentisate 1,2-dioxygenase activity  
GO:0046872  F:metal ion binding  
GO:0006559  P:L-phenylalanine catabolic process  
GO:0006570  P:tyrosine metabolic process  
Pfam View protein in Pfam  
PF04209  HgmA_C  
Amino Acid Sequences MAEFMGLIDGSYDAKEGGGFVPGGASLHNTMSGHGPDAATFEKASTADLVPTKVGQGSMAFMFETSFMLGVSQWGLKECGKLQATYNAESWQPAKRHFKNPGKEQGSTDVALTVRDGLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.06
8 0.07
9 0.07
10 0.07
11 0.06
12 0.07
13 0.07
14 0.07
15 0.09
16 0.09
17 0.1
18 0.12
19 0.13
20 0.12
21 0.12
22 0.11
23 0.1
24 0.12
25 0.12
26 0.11
27 0.1
28 0.09
29 0.09
30 0.09
31 0.1
32 0.09
33 0.08
34 0.09
35 0.1
36 0.1
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.08
63 0.08
64 0.1
65 0.11
66 0.18
67 0.18
68 0.19
69 0.2
70 0.26
71 0.29
72 0.29
73 0.3
74 0.23
75 0.23
76 0.23
77 0.23
78 0.22
79 0.22
80 0.27
81 0.37
82 0.42
83 0.51
84 0.6
85 0.68
86 0.71
87 0.78
88 0.81
89 0.76
90 0.72
91 0.66
92 0.62
93 0.56
94 0.46
95 0.37
96 0.29
97 0.24
98 0.22
99 0.19
100 0.15