Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168D0U0

Protein Details
Accession A0A168D0U0   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-158VADEDPSKKKGKKKAPKRGLDIVDEBasic
NLS Segment(s)
PositionSequence
140-152SKKKGKKKAPKRG
163-170GKKKKLSK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MAEPRVRLTRHHGQLNFGTELRLLLHAYGDPSPHHSFPQEPLPETLRCLDEIVTDFIIETCHSAAQCASYARRQKIKVDDFRFALRKDPVKLGRVQELFRLERELKEARRAFDQNDDRVGGPGKKDLAELADSVADEDPSKKKGKKKAPKRGLDIVDEETSAGKKKKLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.53
4 0.42
5 0.35
6 0.26
7 0.25
8 0.21
9 0.17
10 0.12
11 0.09
12 0.1
13 0.1
14 0.12
15 0.12
16 0.12
17 0.12
18 0.18
19 0.21
20 0.21
21 0.22
22 0.22
23 0.23
24 0.25
25 0.34
26 0.3
27 0.28
28 0.3
29 0.32
30 0.31
31 0.31
32 0.3
33 0.22
34 0.19
35 0.18
36 0.15
37 0.13
38 0.15
39 0.15
40 0.13
41 0.12
42 0.11
43 0.1
44 0.1
45 0.09
46 0.07
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.09
54 0.09
55 0.11
56 0.16
57 0.23
58 0.27
59 0.33
60 0.34
61 0.38
62 0.45
63 0.52
64 0.55
65 0.53
66 0.52
67 0.48
68 0.5
69 0.48
70 0.39
71 0.35
72 0.29
73 0.28
74 0.27
75 0.31
76 0.3
77 0.3
78 0.33
79 0.31
80 0.35
81 0.34
82 0.32
83 0.29
84 0.31
85 0.29
86 0.26
87 0.28
88 0.22
89 0.2
90 0.24
91 0.26
92 0.23
93 0.31
94 0.33
95 0.3
96 0.35
97 0.36
98 0.33
99 0.38
100 0.42
101 0.35
102 0.35
103 0.35
104 0.29
105 0.29
106 0.31
107 0.22
108 0.18
109 0.18
110 0.17
111 0.16
112 0.16
113 0.15
114 0.14
115 0.14
116 0.13
117 0.11
118 0.1
119 0.1
120 0.11
121 0.11
122 0.09
123 0.08
124 0.11
125 0.13
126 0.16
127 0.23
128 0.28
129 0.35
130 0.45
131 0.56
132 0.64
133 0.73
134 0.8
135 0.84
136 0.88
137 0.88
138 0.88
139 0.82
140 0.75
141 0.68
142 0.62
143 0.52
144 0.43
145 0.35
146 0.27
147 0.23
148 0.24
149 0.23
150 0.21