Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VXC5

Protein Details
Accession A0A167VXC5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-44VNIPKTRRTYCKGKECKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MHAKETPDVDVQESEVNIPKTRRTYCKGKECKKHTQHKVTQYKAGKSSLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.21
4 0.22
5 0.23
6 0.26
7 0.31
8 0.37
9 0.43
10 0.44
11 0.52
12 0.58
13 0.68
14 0.74
15 0.77
16 0.81
17 0.81
18 0.86
19 0.85
20 0.86
21 0.86
22 0.86
23 0.84
24 0.84
25 0.87
26 0.79
27 0.78
28 0.72
29 0.66
30 0.59
31 0.54
32 0.43
33 0.35
34 0.34
35 0.35
36 0.34
37 0.31
38 0.36
39 0.41
40 0.47
41 0.51
42 0.54
43 0.5
44 0.55
45 0.62
46 0.59
47 0.59
48 0.56
49 0.55
50 0.54
51 0.57
52 0.48
53 0.44
54 0.4
55 0.33
56 0.36
57 0.38
58 0.37
59 0.32
60 0.39
61 0.43
62 0.52
63 0.61
64 0.63
65 0.63
66 0.66
67 0.73
68 0.74
69 0.72
70 0.69
71 0.64
72 0.61
73 0.6
74 0.54
75 0.5
76 0.47
77 0.41
78 0.35
79 0.32
80 0.32
81 0.35
82 0.41
83 0.43
84 0.47
85 0.57
86 0.63
87 0.68
88 0.66
89 0.6
90 0.56
91 0.51
92 0.5
93 0.5
94 0.5
95 0.52
96 0.54
97 0.52
98 0.49
99 0.49
100 0.42