FuNGI

A0A162I4A5

Protein Details

Accession

A0A162I4A5

Localization Confidence

High

Confidence Score

23.1

NoLS Segment(s)

Position	Sequence	Protein Nature
23-45	GESYRPSSTRSRRPSPRSAAISS	Hydrophilic
73-108	PSSAPTSSRPPPRPRSRSPNFRRRSRSPFYRSRAFP	Hydrophilic
193-214	SPPPRPRYDRARDRERERDRDR	Basic
235-254	GPLSRPRSRSPPPRDTRRGP	Basic
589-608	PYPSRPTYRQQQLQQQQQQQ	Hydrophilic
656-678	QVEEKQKAKRARLREWDRLVRES	Hydrophilic

NLS Segment(s)

Position	Sequence
33-59	SRRPSPRSAAISSRNPSRGPPSHGPSR
80-101	SRPPPRPRSRSPNFRRRSRSPF
162-265	DRSPPPLKRHRSPSPATSSYRARSPKRDRFASPPPRPRYDRARDRERERDRDRDRDRDRDRDRDRDRDRADSPGPLSRPRSRSPPPRDTRRGPYAEKAFWRRRS
384-412	REREREREREKEKEREIEIERERERERER

Subcellular Location(s)

nucl 23, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR033102 NELFE
Gene Ontology	GO:0005694 C:chromosome GO:0032021 C:NELF complex GO:0003723 F:RNA binding GO:0006355 P:regulation of DNA-templated transcription

Amino Acid Sequences

MDRDRDPPPRDRRFDDSWRAPPGESYRPSSTRSRRPSPRSAAISSRNPSRGPPSHGPSRGASPARPIVDSWAPSSAPTSSRPPPRPRSRSPNFRRRSRSPFYRSRAFPRDDAGGPPPSLAPSSSSRRFSPSPRDVRRPFYSNRSPPSAPLASSSSSSRFARDRSPPPLKRHRSPSPATSSYRARSPKRDRFASPPPRPRYDRARDRERERDRDRDRDRDRDRDRDRDRDRADSPGPLSRPRSRSPPPRDTRRGPYAEKAFWRRRSPPPFAQDSSSSGPSGYPGRSPAYYRRPRNTSRPPPRPSSPYYARSPPRRDTHSREPSVTRQPSSPFPPSRAAAAPASAAAATVAAANTAAAVSPPLDSPQKARRPSYDVSADWDRDREREREREREREKEKEREIEIERERERERERDRDRAYHSRHPSSPSQAQQQAQPTPAAPQSATREPSSSSRFGGSERGSTFLPSRPRPHLQDSPRPTSPTSMAPSAPASLPRGPRAGPGAPGVLSAPTRPRGAYGRDPPPYARGGERDIPSRPRGGGPHRSPSYYGPPSGPRGSGGSANSPPGTGFSPPFYDPHRPSPRRHGSFSSGPYPSRPTYRQQQLQQQQQQQQQQNQQPDYLSDLPAIIPGGKLRPSGLDPTIERRLAQLESDRNRLQAQVEEKQKAKRARLREWDRLVRESATGALRSEFAEAQLQKLTEPDSVVGEVAF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.76
3	0.75
4	0.72
5	0.72
6	0.68
7	0.61
8	0.58
9	0.55
10	0.54
11	0.49
12	0.48
13	0.49
14	0.5
15	0.54
16	0.58
17	0.61
18	0.62
19	0.68
20	0.71
21	0.74
22	0.79
23	0.85
24	0.84
25	0.84
26	0.8
27	0.77
28	0.75
29	0.72
30	0.73
31	0.68
32	0.67
33	0.61
34	0.55
35	0.53
36	0.54
37	0.52
38	0.52
39	0.56
40	0.55
41	0.61
42	0.65
43	0.64
44	0.57
45	0.56
46	0.56
47	0.5
48	0.44
49	0.42
50	0.44
51	0.43
52	0.41
53	0.35
54	0.33
55	0.36
56	0.36
57	0.31
58	0.28
59	0.26
60	0.25
61	0.26
62	0.23
63	0.19
64	0.21
65	0.26
66	0.31
67	0.41
68	0.49
69	0.57
70	0.66
71	0.75
72	0.8
73	0.83
74	0.86
75	0.86
76	0.88
77	0.89
78	0.89
79	0.87
80	0.89
81	0.88
82	0.86
83	0.85
84	0.84
85	0.84
86	0.82
87	0.84
88	0.81
89	0.82
90	0.78
91	0.78
92	0.77
93	0.71
94	0.63
95	0.56
96	0.54
97	0.46
98	0.44
99	0.39
100	0.34
101	0.3
102	0.29
103	0.25
104	0.21
105	0.2
106	0.17
107	0.16
108	0.18
109	0.26
110	0.32
111	0.35
112	0.36
113	0.41
114	0.44
115	0.48
116	0.52
117	0.54
118	0.59
119	0.63
120	0.72
121	0.71
122	0.75
123	0.75
124	0.7
125	0.65
126	0.64
127	0.67
128	0.65
129	0.66
130	0.65
131	0.59
132	0.54
133	0.57
134	0.49
135	0.39
136	0.34
137	0.31
138	0.25
139	0.26
140	0.27
141	0.22
142	0.24
143	0.24
144	0.24
145	0.24
146	0.26
147	0.32
148	0.38
149	0.43
150	0.48
151	0.58
152	0.62
153	0.68
154	0.77
155	0.78
156	0.77
157	0.79
158	0.79
159	0.77
160	0.74
161	0.74
162	0.72
163	0.69
164	0.65
165	0.61
166	0.58
167	0.51
168	0.54
169	0.53
170	0.5
171	0.54
172	0.61
173	0.66
174	0.68
175	0.72
176	0.69
177	0.69
178	0.74
179	0.75
180	0.74
181	0.75
182	0.73
183	0.74
184	0.75
185	0.73
186	0.72
187	0.72
188	0.72
189	0.71
190	0.75
191	0.75
192	0.78
193	0.83
194	0.81
195	0.81
196	0.76
197	0.77
198	0.73
199	0.75
200	0.74
201	0.74
202	0.72
203	0.72
204	0.73
205	0.72
206	0.72
207	0.72
208	0.72
209	0.72
210	0.72
211	0.72
212	0.71
213	0.7
214	0.67
215	0.63
216	0.58
217	0.54
218	0.49
219	0.42
220	0.4
221	0.35
222	0.34
223	0.32
224	0.37
225	0.38
226	0.42
227	0.41
228	0.47
229	0.49
230	0.58
231	0.63
232	0.68
233	0.7
234	0.75
235	0.8
236	0.78
237	0.78
238	0.76
239	0.72
240	0.64
241	0.63
242	0.59
243	0.55
244	0.55
245	0.56
246	0.56
247	0.57
248	0.6
249	0.59
250	0.63
251	0.66
252	0.68
253	0.67
254	0.65
255	0.64
256	0.6
257	0.56
258	0.48
259	0.45
260	0.41
261	0.34
262	0.27
263	0.21
264	0.19
265	0.17
266	0.18
267	0.14
268	0.11
269	0.12
270	0.14
271	0.15
272	0.18
273	0.25
274	0.33
275	0.41
276	0.47
277	0.53
278	0.58
279	0.62
280	0.69
281	0.72
282	0.73
283	0.74
284	0.77
285	0.75
286	0.75
287	0.74
288	0.7
289	0.64
290	0.61
291	0.57
292	0.52
293	0.52
294	0.53
295	0.55
296	0.58
297	0.6
298	0.58
299	0.57
300	0.58
301	0.61
302	0.61
303	0.66
304	0.67
305	0.63
306	0.59
307	0.57
308	0.56
309	0.59
310	0.53
311	0.43
312	0.36
313	0.35
314	0.37
315	0.38
316	0.4
317	0.32
318	0.32
319	0.35
320	0.33
321	0.33
322	0.3
323	0.27
324	0.19
325	0.18
326	0.15
327	0.11
328	0.11
329	0.07
330	0.06
331	0.04
332	0.03
333	0.03
334	0.03
335	0.03
336	0.03
337	0.03
338	0.03
339	0.03
340	0.03
341	0.02
342	0.02
343	0.02
344	0.03
345	0.03
346	0.04
347	0.06
348	0.07
349	0.07
350	0.12
351	0.21
352	0.28
353	0.31
354	0.33
355	0.35
356	0.4
357	0.41
358	0.42
359	0.37
360	0.3
361	0.32
362	0.33
363	0.31
364	0.26
365	0.27
366	0.22
367	0.2
368	0.23
369	0.23
370	0.25
371	0.33
372	0.38
373	0.47
374	0.51
375	0.59
376	0.61
377	0.65
378	0.65
379	0.65
380	0.66
381	0.65
382	0.64
383	0.59
384	0.56
385	0.52
386	0.5
387	0.48
388	0.45
389	0.44
390	0.4
391	0.38
392	0.38
393	0.37
394	0.37
395	0.37
396	0.4
397	0.43
398	0.47
399	0.52
400	0.55
401	0.56
402	0.6
403	0.61
404	0.62
405	0.61
406	0.63
407	0.59
408	0.58
409	0.56
410	0.53
411	0.5
412	0.5
413	0.44
414	0.45
415	0.44
416	0.43
417	0.42
418	0.44
419	0.39
420	0.33
421	0.3
422	0.23
423	0.21
424	0.21
425	0.18
426	0.13
427	0.15
428	0.19
429	0.23
430	0.25
431	0.23
432	0.23
433	0.24
434	0.29
435	0.3
436	0.27
437	0.23
438	0.22
439	0.22
440	0.22
441	0.26
442	0.22
443	0.22
444	0.21
445	0.22
446	0.2
447	0.21
448	0.22
449	0.21
450	0.27
451	0.27
452	0.32
453	0.36
454	0.42
455	0.45
456	0.51
457	0.55
458	0.56
459	0.61
460	0.63
461	0.64
462	0.62
463	0.59
464	0.52
465	0.46
466	0.41
467	0.36
468	0.32
469	0.27
470	0.25
471	0.24
472	0.24
473	0.22
474	0.2
475	0.17
476	0.17
477	0.19
478	0.21
479	0.22
480	0.23
481	0.22
482	0.24
483	0.27
484	0.25
485	0.22
486	0.21
487	0.2
488	0.18
489	0.18
490	0.16
491	0.12
492	0.11
493	0.11
494	0.13
495	0.15
496	0.16
497	0.15
498	0.18
499	0.21
500	0.27
501	0.34
502	0.39
503	0.45
504	0.47
505	0.49
506	0.48
507	0.46
508	0.42
509	0.35
510	0.29
511	0.24
512	0.26
513	0.31
514	0.32
515	0.33
516	0.35
517	0.38
518	0.38
519	0.37
520	0.33
521	0.3
522	0.34
523	0.38
524	0.44
525	0.45
526	0.53
527	0.53
528	0.53
529	0.52
530	0.5
531	0.52
532	0.45
533	0.41
534	0.34
535	0.36
536	0.4
537	0.4
538	0.36
539	0.28
540	0.27
541	0.26
542	0.27
543	0.24
544	0.24
545	0.23
546	0.26
547	0.24
548	0.22
549	0.2
550	0.18
551	0.18
552	0.15
553	0.15
554	0.14
555	0.18
556	0.19
557	0.21
558	0.24
559	0.32
560	0.34
561	0.43
562	0.52
563	0.53
564	0.57
565	0.66
566	0.72
567	0.69
568	0.71
569	0.66
570	0.62
571	0.66
572	0.65
573	0.61
574	0.53
575	0.48
576	0.46
577	0.46
578	0.41
579	0.41
580	0.39
581	0.38
582	0.45
583	0.54
584	0.6
585	0.62
586	0.7
587	0.72
588	0.79
589	0.81
590	0.8
591	0.77
592	0.76
593	0.78
594	0.75
595	0.74
596	0.72
597	0.71
598	0.71
599	0.64
600	0.59
601	0.51
602	0.44
603	0.43
604	0.36
605	0.3
606	0.21
607	0.2
608	0.18
609	0.18
610	0.17
611	0.1
612	0.09
613	0.1
614	0.13
615	0.15
616	0.16
617	0.16
618	0.18
619	0.21
620	0.26
621	0.26
622	0.28
623	0.28
624	0.35
625	0.41
626	0.39
627	0.36
628	0.32
629	0.33
630	0.28
631	0.3
632	0.3
633	0.33
634	0.37
635	0.45
636	0.44
637	0.43
638	0.43
639	0.41
640	0.36
641	0.33
642	0.35
643	0.36
644	0.43
645	0.47
646	0.5
647	0.55
648	0.61
649	0.63
650	0.66
651	0.65
652	0.66
653	0.71
654	0.78
655	0.8
656	0.82
657	0.84
658	0.84
659	0.81
660	0.76
661	0.68
662	0.59
663	0.5
664	0.41
665	0.36
666	0.29
667	0.25
668	0.22
669	0.2
670	0.2
671	0.19
672	0.21
673	0.17
674	0.15
675	0.22
676	0.21
677	0.22
678	0.25
679	0.25
680	0.22
681	0.23
682	0.24
683	0.18
684	0.19
685	0.18
686	0.17
687	0.17

A0A162I4A5

3D AlphaFold-predicted Structure Viewer