Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SGM8

Protein Details
Accession Q7SGM8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
121-140DASSKPKRGRPPGPKKRALSBasic
161-180RNNIAAKKYRQKKIDRIQELHydrophilic
NLS Segment(s)
PositionSequence
125-138KPKRGRPPGPKKRA
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR031106  C/EBP  
Gene Ontology GO:0005667  C:transcription regulator complex  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0001080  P:nitrogen catabolite activation of transcription from RNA polymerase II promoter  
GO:1903833  P:positive regulation of cellular response to amino acid starvation  
KEGG ncr:NCU08055  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14686  bZIP  
Amino Acid Sequences MHLSLDHHHLSSDDPYAAASLSHVTDTLSTTMGLTMPSGRNTTTLGMDMFRTASNNSGSSNNNMGYSQLNATTSSSSRDHSTTPPTSQSSGSTSPTASTSHHGHGGQGHLYPGLTLPSPVDASSKPKRGRPPGPKKRALSPSVAAEAELTDSEDIMIKRQRNNIAAKKYRQKKIDRIQELEEEVDQIKKEREELRLMLAKRDAEVGMLREMLAMAKQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.11
6 0.09
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.09
13 0.11
14 0.11
15 0.1
16 0.09
17 0.09
18 0.1
19 0.1
20 0.09
21 0.08
22 0.11
23 0.13
24 0.14
25 0.16
26 0.15
27 0.16
28 0.18
29 0.19
30 0.16
31 0.15
32 0.14
33 0.13
34 0.13
35 0.13
36 0.12
37 0.11
38 0.11
39 0.1
40 0.12
41 0.13
42 0.14
43 0.15
44 0.17
45 0.18
46 0.2
47 0.23
48 0.2
49 0.19
50 0.18
51 0.18
52 0.15
53 0.15
54 0.13
55 0.11
56 0.11
57 0.1
58 0.11
59 0.12
60 0.12
61 0.14
62 0.14
63 0.15
64 0.16
65 0.17
66 0.18
67 0.19
68 0.26
69 0.25
70 0.26
71 0.28
72 0.28
73 0.28
74 0.27
75 0.25
76 0.23
77 0.22
78 0.22
79 0.19
80 0.17
81 0.16
82 0.16
83 0.16
84 0.12
85 0.14
86 0.15
87 0.15
88 0.18
89 0.17
90 0.17
91 0.17
92 0.17
93 0.15
94 0.12
95 0.11
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.05
102 0.04
103 0.04
104 0.05
105 0.06
106 0.06
107 0.08
108 0.08
109 0.15
110 0.21
111 0.29
112 0.3
113 0.35
114 0.43
115 0.5
116 0.59
117 0.64
118 0.7
119 0.73
120 0.8
121 0.83
122 0.78
123 0.78
124 0.75
125 0.67
126 0.6
127 0.52
128 0.45
129 0.4
130 0.37
131 0.28
132 0.2
133 0.17
134 0.13
135 0.1
136 0.08
137 0.05
138 0.05
139 0.05
140 0.08
141 0.08
142 0.11
143 0.16
144 0.19
145 0.23
146 0.29
147 0.34
148 0.37
149 0.46
150 0.51
151 0.57
152 0.62
153 0.66
154 0.71
155 0.75
156 0.77
157 0.76
158 0.76
159 0.76
160 0.78
161 0.81
162 0.78
163 0.73
164 0.7
165 0.66
166 0.59
167 0.5
168 0.4
169 0.31
170 0.24
171 0.21
172 0.17
173 0.15
174 0.17
175 0.16
176 0.21
177 0.24
178 0.28
179 0.31
180 0.33
181 0.38
182 0.42
183 0.42
184 0.42
185 0.41
186 0.37
187 0.32
188 0.33
189 0.25
190 0.2
191 0.22
192 0.19
193 0.17
194 0.17
195 0.16
196 0.14
197 0.14
198 0.13
199 0.1