Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SAW2

Protein Details
Accession Q7SAW2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-35GERGILKKPIKKFVKKPIKKPVKKPAEEKPTEBasic
98-117AEEKPIKKPGKKPAGKKPAEBasic
NLS Segment(s)
PositionSequence
8-130ILKKPIKKFVKKPIKKPVKKPAEEKPTENKPGIKPAEEKPAEEKPTEEKPGKKPSKKSGKKPAEEKPAEEKPGKKPGKKLASKKPAEEKPAEEKPIKKPGKKPAGKKPAEEKPTEEKLVKKKY
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG ncr:NCU05672  -  
Amino Acid Sequences MIIGERGILKKPIKKFVKKPIKKPVKKPAEEKPTENKPGIKPAEEKPAEEKPTEEKPGKKPSKKSGKKPAEEKPAEEKPGKKPGKKLASKKPAEEKPAEEKPIKKPGKKPAGKKPAEEKPTEEKLVKKKYIRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.75
4 0.8
5 0.83
6 0.86
7 0.87
8 0.89
9 0.88
10 0.89
11 0.89
12 0.88
13 0.86
14 0.83
15 0.82
16 0.81
17 0.77
18 0.72
19 0.7
20 0.67
21 0.65
22 0.61
23 0.56
24 0.47
25 0.52
26 0.49
27 0.43
28 0.38
29 0.37
30 0.45
31 0.4
32 0.39
33 0.35
34 0.4
35 0.39
36 0.35
37 0.33
38 0.27
39 0.32
40 0.36
41 0.35
42 0.33
43 0.38
44 0.49
45 0.57
46 0.58
47 0.59
48 0.64
49 0.71
50 0.75
51 0.78
52 0.78
53 0.78
54 0.78
55 0.78
56 0.77
57 0.76
58 0.69
59 0.62
60 0.59
61 0.54
62 0.51
63 0.47
64 0.42
65 0.37
66 0.47
67 0.5
68 0.45
69 0.47
70 0.54
71 0.61
72 0.66
73 0.69
74 0.7
75 0.74
76 0.74
77 0.74
78 0.74
79 0.69
80 0.66
81 0.6
82 0.54
83 0.51
84 0.54
85 0.53
86 0.47
87 0.45
88 0.47
89 0.55
90 0.57
91 0.56
92 0.58
93 0.64
94 0.71
95 0.75
96 0.77
97 0.77
98 0.81
99 0.78
100 0.78
101 0.76
102 0.75
103 0.73
104 0.67
105 0.62
106 0.59
107 0.62
108 0.6
109 0.54
110 0.51
111 0.55
112 0.62
113 0.64
114 0.62