Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162I8J5

Protein Details
Accession A0A162I8J5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-40IPQRMHIKTKDLKQKRRKGTPKYLDECPHydrophilic
NLS Segment(s)
PositionSequence
25-30KQKRRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024645  Mitochondr_Som1  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
Pfam View protein in Pfam  
PF11093  Mitochondr_Som1  
Amino Acid Sequences MAPLIDLFPASDIPQRMHIKTKDLKQKRRKGTPKYLDECPLYELVQYSCNPPDREPPPPGEINCESFVRLFRRCANGLSVETTAWEMRPEDTQDSTEKMMKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.3
4 0.38
5 0.38
6 0.42
7 0.48
8 0.55
9 0.57
10 0.63
11 0.71
12 0.74
13 0.82
14 0.84
15 0.88
16 0.89
17 0.88
18 0.89
19 0.88
20 0.87
21 0.82
22 0.76
23 0.69
24 0.61
25 0.52
26 0.43
27 0.33
28 0.23
29 0.19
30 0.16
31 0.12
32 0.13
33 0.12
34 0.12
35 0.14
36 0.18
37 0.19
38 0.19
39 0.26
40 0.26
41 0.3
42 0.3
43 0.31
44 0.31
45 0.33
46 0.32
47 0.31
48 0.3
49 0.28
50 0.28
51 0.25
52 0.22
53 0.19
54 0.23
55 0.21
56 0.21
57 0.21
58 0.23
59 0.29
60 0.29
61 0.3
62 0.3
63 0.29
64 0.28
65 0.28
66 0.25
67 0.19
68 0.18
69 0.18
70 0.16
71 0.13
72 0.13
73 0.1
74 0.11
75 0.15
76 0.17
77 0.19
78 0.21
79 0.23
80 0.24
81 0.26
82 0.29
83 0.3
84 0.31