Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167ZV19

Protein Details
Accession A0A167ZV19    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
207-230APSRIKRGVVPARRHRRRTTVAKEBasic
NLS Segment(s)
PositionSequence
212-224KRGVVPARRHRRR
Subcellular Location(s) nucl 8, cyto 6, extr 6, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019623  Rot1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006458  P:'de novo' protein folding  
Pfam View protein in Pfam  
PF10681  Rot1  
Amino Acid Sequences MLVQSAVRDGGLPSLLSVLAAIFVVCVTLCAADERKIDSDLVGTWVSKSEKVKTGPNFYDPKKDEFNEPSLPGMSYSFSKDGHYEEALYRAIANPSKPDCTKAILQFQHGTWYVAENGSLILEPIKVDGRQQVSDPCKHDDHSIYSRYNQTELFKKYEVREDSYHKKKRLDLYQFDGSPVNAMLLNDENPSMLPTTTLNPMTSATTAPSRIKRGVVPARRHRRRTTVAKEGMGAADRWWWLGVIMTSAGGLMLFYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.08
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.08
18 0.11
19 0.15
20 0.17
21 0.2
22 0.21
23 0.22
24 0.22
25 0.19
26 0.18
27 0.15
28 0.17
29 0.14
30 0.12
31 0.11
32 0.15
33 0.17
34 0.19
35 0.21
36 0.24
37 0.3
38 0.33
39 0.4
40 0.42
41 0.5
42 0.49
43 0.53
44 0.55
45 0.5
46 0.58
47 0.52
48 0.51
49 0.48
50 0.47
51 0.46
52 0.43
53 0.46
54 0.4
55 0.38
56 0.34
57 0.29
58 0.28
59 0.22
60 0.19
61 0.14
62 0.11
63 0.14
64 0.14
65 0.13
66 0.14
67 0.15
68 0.16
69 0.18
70 0.17
71 0.16
72 0.14
73 0.16
74 0.16
75 0.14
76 0.13
77 0.11
78 0.13
79 0.13
80 0.13
81 0.15
82 0.17
83 0.22
84 0.22
85 0.23
86 0.22
87 0.24
88 0.28
89 0.27
90 0.34
91 0.31
92 0.33
93 0.32
94 0.31
95 0.31
96 0.27
97 0.24
98 0.16
99 0.15
100 0.13
101 0.11
102 0.11
103 0.07
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.06
113 0.05
114 0.06
115 0.1
116 0.12
117 0.13
118 0.14
119 0.19
120 0.22
121 0.26
122 0.29
123 0.28
124 0.27
125 0.28
126 0.29
127 0.25
128 0.27
129 0.28
130 0.29
131 0.27
132 0.28
133 0.31
134 0.3
135 0.29
136 0.24
137 0.23
138 0.26
139 0.28
140 0.29
141 0.27
142 0.29
143 0.3
144 0.36
145 0.36
146 0.33
147 0.34
148 0.37
149 0.45
150 0.52
151 0.59
152 0.56
153 0.57
154 0.57
155 0.62
156 0.65
157 0.64
158 0.59
159 0.58
160 0.61
161 0.57
162 0.53
163 0.46
164 0.35
165 0.27
166 0.21
167 0.15
168 0.08
169 0.08
170 0.08
171 0.09
172 0.1
173 0.1
174 0.1
175 0.09
176 0.08
177 0.09
178 0.09
179 0.07
180 0.07
181 0.08
182 0.1
183 0.14
184 0.15
185 0.15
186 0.15
187 0.16
188 0.17
189 0.17
190 0.15
191 0.13
192 0.14
193 0.18
194 0.22
195 0.26
196 0.29
197 0.31
198 0.33
199 0.33
200 0.4
201 0.47
202 0.51
203 0.56
204 0.63
205 0.72
206 0.79
207 0.84
208 0.81
209 0.81
210 0.81
211 0.82
212 0.8
213 0.79
214 0.76
215 0.71
216 0.65
217 0.57
218 0.49
219 0.4
220 0.31
221 0.21
222 0.18
223 0.16
224 0.16
225 0.14
226 0.12
227 0.11
228 0.13
229 0.13
230 0.11
231 0.11
232 0.1
233 0.09
234 0.09
235 0.09
236 0.06