Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168DJS1

Protein Details
Accession A0A168DJS1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-40EEPQTKQPSYWQQRIRRRFTGMHydrophilic
331-353REKHKFSTYLKLRWNRNNPKADVHydrophilic
368-397AVSRSSFKNYWRHIRWKKQRTQEPAPPDTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 2
Family & Domain DBs
Amino Acid Sequences MWSPSSTSHDDETNETLVEEPQTKQPSYWQQRIRRRFTGMSRGFAFTPLTSFSMPALASKSWDASSDNDSIILHKSKSWQWTCPRIVLDAQNLEQFLVFAMGSEERKSTVQYTLIDLELDLSNSNPSDFCDLPDLQLGAIDYKKPLIYEFAEVLSSMLSLLKELLDGCRRLKRYSYRSSPSLDAIMHHTAGMSIRDMTLTPMMGMGSLRILKIDTTQLDCFSPLHHLCPVVRQFLCNVSELHLTVHTLCPRALIPGDRDPIPLQRLYITILPPPRDDQLNPRGLAVRCGSTAMSPYDLVQYEAAMKKKAVKLAKQMRNPEIVSIEMPVVVREKHKFSTYLKLRWNRNNPKADVVIGYESFNAVSKASAVSRSSFKNYWRHIRWKKQRTQEPAPPDTNENETC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.21
4 0.18
5 0.2
6 0.19
7 0.17
8 0.23
9 0.28
10 0.29
11 0.28
12 0.35
13 0.43
14 0.5
15 0.58
16 0.59
17 0.65
18 0.75
19 0.85
20 0.85
21 0.8
22 0.78
23 0.77
24 0.75
25 0.76
26 0.7
27 0.67
28 0.61
29 0.57
30 0.5
31 0.44
32 0.38
33 0.27
34 0.24
35 0.2
36 0.19
37 0.17
38 0.17
39 0.15
40 0.16
41 0.16
42 0.15
43 0.16
44 0.14
45 0.16
46 0.16
47 0.18
48 0.16
49 0.17
50 0.18
51 0.17
52 0.21
53 0.21
54 0.2
55 0.18
56 0.18
57 0.18
58 0.21
59 0.21
60 0.18
61 0.17
62 0.21
63 0.26
64 0.36
65 0.38
66 0.41
67 0.47
68 0.56
69 0.58
70 0.58
71 0.55
72 0.47
73 0.48
74 0.44
75 0.41
76 0.35
77 0.33
78 0.3
79 0.28
80 0.26
81 0.22
82 0.17
83 0.11
84 0.08
85 0.07
86 0.05
87 0.06
88 0.08
89 0.09
90 0.1
91 0.11
92 0.11
93 0.12
94 0.14
95 0.14
96 0.15
97 0.18
98 0.18
99 0.21
100 0.21
101 0.2
102 0.19
103 0.16
104 0.15
105 0.12
106 0.11
107 0.08
108 0.07
109 0.08
110 0.08
111 0.08
112 0.06
113 0.07
114 0.12
115 0.12
116 0.12
117 0.16
118 0.17
119 0.17
120 0.19
121 0.18
122 0.13
123 0.13
124 0.13
125 0.09
126 0.1
127 0.09
128 0.08
129 0.09
130 0.1
131 0.09
132 0.09
133 0.11
134 0.12
135 0.14
136 0.14
137 0.14
138 0.14
139 0.13
140 0.13
141 0.09
142 0.07
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.05
151 0.08
152 0.11
153 0.13
154 0.16
155 0.21
156 0.24
157 0.25
158 0.31
159 0.37
160 0.42
161 0.5
162 0.56
163 0.55
164 0.56
165 0.58
166 0.53
167 0.45
168 0.38
169 0.29
170 0.21
171 0.2
172 0.18
173 0.15
174 0.13
175 0.12
176 0.1
177 0.11
178 0.1
179 0.06
180 0.05
181 0.05
182 0.06
183 0.06
184 0.07
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.04
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.07
200 0.09
201 0.09
202 0.12
203 0.13
204 0.14
205 0.14
206 0.14
207 0.13
208 0.11
209 0.16
210 0.13
211 0.14
212 0.14
213 0.15
214 0.15
215 0.21
216 0.23
217 0.23
218 0.22
219 0.21
220 0.21
221 0.25
222 0.26
223 0.2
224 0.18
225 0.15
226 0.16
227 0.16
228 0.16
229 0.11
230 0.11
231 0.11
232 0.14
233 0.13
234 0.13
235 0.13
236 0.13
237 0.13
238 0.14
239 0.15
240 0.14
241 0.16
242 0.21
243 0.24
244 0.23
245 0.25
246 0.24
247 0.27
248 0.27
249 0.23
250 0.17
251 0.16
252 0.16
253 0.17
254 0.18
255 0.16
256 0.17
257 0.21
258 0.22
259 0.22
260 0.24
261 0.24
262 0.23
263 0.23
264 0.27
265 0.32
266 0.36
267 0.35
268 0.34
269 0.38
270 0.36
271 0.39
272 0.32
273 0.25
274 0.19
275 0.2
276 0.19
277 0.14
278 0.16
279 0.13
280 0.13
281 0.12
282 0.12
283 0.14
284 0.14
285 0.15
286 0.12
287 0.12
288 0.15
289 0.19
290 0.2
291 0.18
292 0.19
293 0.24
294 0.28
295 0.34
296 0.36
297 0.38
298 0.47
299 0.57
300 0.65
301 0.66
302 0.7
303 0.67
304 0.67
305 0.61
306 0.53
307 0.44
308 0.36
309 0.29
310 0.23
311 0.19
312 0.14
313 0.13
314 0.11
315 0.12
316 0.12
317 0.16
318 0.19
319 0.23
320 0.25
321 0.28
322 0.32
323 0.34
324 0.43
325 0.47
326 0.52
327 0.56
328 0.61
329 0.67
330 0.74
331 0.81
332 0.81
333 0.82
334 0.83
335 0.77
336 0.75
337 0.68
338 0.59
339 0.5
340 0.42
341 0.36
342 0.28
343 0.26
344 0.2
345 0.18
346 0.16
347 0.15
348 0.13
349 0.09
350 0.08
351 0.08
352 0.1
353 0.12
354 0.16
355 0.16
356 0.19
357 0.24
358 0.28
359 0.34
360 0.36
361 0.41
362 0.47
363 0.54
364 0.61
365 0.65
366 0.72
367 0.76
368 0.83
369 0.88
370 0.89
371 0.9
372 0.9
373 0.91
374 0.9
375 0.89
376 0.87
377 0.85
378 0.83
379 0.78
380 0.71
381 0.65
382 0.59