Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SCW6

Protein Details
Accession Q7SCW6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-65INALMTKRRKDRKDRNETDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR045222  Rpb4-like  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
Gene Ontology GO:0005665  C:RNA polymerase II, core complex  
GO:0000166  F:nucleotide binding  
GO:0031369  F:translation initiation factor binding  
GO:0034402  P:recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
KEGG ncr:NCU09378  -  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MSDQHHAPTSRSKPPPPGEEEASAVLKLGEFQDVDTLTLSEASLVINALMTKRRKDRKDRNETDVLNKTLDYLDAFARFKQKENVEAVERLLSARKELTKFERAQIGSLCCDSADECKTLIPSLADKITDDELQELLDEMAKLMST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.64
4 0.64
5 0.59
6 0.54
7 0.51
8 0.45
9 0.39
10 0.31
11 0.24
12 0.18
13 0.13
14 0.12
15 0.1
16 0.08
17 0.07
18 0.07
19 0.1
20 0.11
21 0.11
22 0.11
23 0.1
24 0.09
25 0.09
26 0.08
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.11
37 0.14
38 0.18
39 0.27
40 0.36
41 0.43
42 0.54
43 0.64
44 0.7
45 0.79
46 0.8
47 0.78
48 0.77
49 0.71
50 0.68
51 0.62
52 0.52
53 0.41
54 0.35
55 0.29
56 0.21
57 0.19
58 0.12
59 0.08
60 0.07
61 0.09
62 0.1
63 0.1
64 0.16
65 0.16
66 0.18
67 0.22
68 0.23
69 0.25
70 0.28
71 0.3
72 0.27
73 0.27
74 0.26
75 0.21
76 0.19
77 0.15
78 0.15
79 0.12
80 0.1
81 0.12
82 0.15
83 0.16
84 0.2
85 0.26
86 0.3
87 0.32
88 0.34
89 0.38
90 0.35
91 0.35
92 0.35
93 0.32
94 0.26
95 0.25
96 0.22
97 0.15
98 0.15
99 0.13
100 0.14
101 0.14
102 0.13
103 0.13
104 0.14
105 0.15
106 0.15
107 0.16
108 0.13
109 0.13
110 0.16
111 0.17
112 0.17
113 0.17
114 0.19
115 0.21
116 0.2
117 0.18
118 0.16
119 0.14
120 0.14
121 0.13
122 0.11
123 0.08
124 0.09
125 0.09
126 0.08