Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A261Y7L9

Protein Details
Accession A0A261Y7L9   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-135DTSGSGTKSKKKVKKDAKKAGLLSFHydrophilic
NLS Segment(s)
PositionSequence
74-74K
77-85IGSKGSKRK
118-129KSKKKVKKDAKK
Subcellular Location(s) nucl 18.5, mito_nucl 14, mito 8.5
Family & Domain DBs
Amino Acid Sequences MATSEKRQEVLRAMQVRIGPVIKKITSQLQQVSRHVLAFPVSTHASDDETPALDESGKPLFRRKPTSSKETGSKAIIGSKGSKRKHASDQTSNDVSPTHDQADQANAKPSDTSGSGTKSKKKVKKDAKKAGLLSFDHEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.34
5 0.3
6 0.22
7 0.21
8 0.26
9 0.23
10 0.23
11 0.25
12 0.3
13 0.31
14 0.35
15 0.38
16 0.41
17 0.45
18 0.45
19 0.48
20 0.42
21 0.38
22 0.33
23 0.27
24 0.2
25 0.16
26 0.15
27 0.13
28 0.13
29 0.12
30 0.13
31 0.13
32 0.14
33 0.13
34 0.14
35 0.11
36 0.1
37 0.1
38 0.1
39 0.09
40 0.07
41 0.07
42 0.08
43 0.11
44 0.12
45 0.12
46 0.18
47 0.24
48 0.29
49 0.37
50 0.4
51 0.46
52 0.5
53 0.57
54 0.56
55 0.54
56 0.53
57 0.49
58 0.46
59 0.36
60 0.32
61 0.25
62 0.23
63 0.2
64 0.17
65 0.18
66 0.22
67 0.29
68 0.3
69 0.37
70 0.38
71 0.42
72 0.5
73 0.55
74 0.56
75 0.57
76 0.61
77 0.61
78 0.59
79 0.54
80 0.45
81 0.36
82 0.3
83 0.24
84 0.21
85 0.17
86 0.15
87 0.16
88 0.16
89 0.23
90 0.24
91 0.23
92 0.28
93 0.26
94 0.25
95 0.25
96 0.24
97 0.2
98 0.18
99 0.19
100 0.15
101 0.2
102 0.27
103 0.32
104 0.4
105 0.46
106 0.55
107 0.6
108 0.67
109 0.73
110 0.77
111 0.84
112 0.87
113 0.89
114 0.88
115 0.89
116 0.84
117 0.78
118 0.74
119 0.64