Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A261Y7V6

Protein Details
Accession A0A261Y7V6    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-100MWTNRGRVKKCQKSMARIKFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038340  MRP-L47_sf  
IPR036049  Ribosomal_L29/L35_sf  
IPR010729  Ribosomal_L47_mit  
Gene Ontology GO:0005761  C:mitochondrial ribosome  
GO:1990904  C:ribonucleoprotein complex  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF06984  MRP-L47  
Amino Acid Sequences MFSLVRAFSSSACRASLAQFFEAGQALPPQTYTGRAWRASELRQKSFDDLHKLWYVLLKERNRLATQNEEARRLGITKQMWTNRGRVKKCQKSMARIKFVLNERQNSYEQAMAQKHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.27
4 0.23
5 0.21
6 0.2
7 0.19
8 0.19
9 0.19
10 0.15
11 0.11
12 0.1
13 0.09
14 0.09
15 0.09
16 0.09
17 0.1
18 0.13
19 0.14
20 0.19
21 0.23
22 0.25
23 0.26
24 0.29
25 0.32
26 0.35
27 0.41
28 0.41
29 0.4
30 0.42
31 0.41
32 0.39
33 0.4
34 0.38
35 0.37
36 0.31
37 0.32
38 0.3
39 0.28
40 0.26
41 0.24
42 0.22
43 0.19
44 0.26
45 0.24
46 0.25
47 0.27
48 0.3
49 0.29
50 0.29
51 0.27
52 0.26
53 0.28
54 0.33
55 0.33
56 0.32
57 0.31
58 0.3
59 0.27
60 0.22
61 0.19
62 0.17
63 0.17
64 0.18
65 0.25
66 0.29
67 0.32
68 0.33
69 0.4
70 0.42
71 0.5
72 0.5
73 0.54
74 0.61
75 0.67
76 0.72
77 0.75
78 0.74
79 0.75
80 0.82
81 0.82
82 0.79
83 0.7
84 0.66
85 0.64
86 0.62
87 0.62
88 0.57
89 0.53
90 0.49
91 0.51
92 0.5
93 0.46
94 0.43
95 0.36
96 0.31
97 0.33