Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7S0I1

Protein Details
Accession Q7S0I1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRELQKRKKRSSRAKVQTHTIKKKVLHydrophilic
NLS Segment(s)
PositionSequence
7-17KRKKRSSRAKV
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0006364  P:rRNA processing  
KEGG ncr:NCU09528  -  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MGRELQKRKKRSSRAKVQTHTIKKKVLNPQGSGIVAKAWNKKETLSQNYSRFGLVAKLGTAAGGMAKKSAAANYAGITKDDPLAVKSADRGLFEVREVKVERDASGKIVKVLRSDNPLNDPLNEIESDSESEEPKPKNPTHDIEWHGISDDRQEMIAQSSRPEVVRMLEEEASRPVEKTVRYQSERELEWLQRLVAKHGDDVAAMVRDIKLNPMQQTKGDITKRLRKAGLLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.88
4 0.88
5 0.88
6 0.87
7 0.86
8 0.81
9 0.77
10 0.72
11 0.74
12 0.75
13 0.74
14 0.7
15 0.63
16 0.61
17 0.58
18 0.54
19 0.46
20 0.35
21 0.28
22 0.24
23 0.26
24 0.29
25 0.29
26 0.31
27 0.31
28 0.32
29 0.37
30 0.43
31 0.46
32 0.47
33 0.51
34 0.53
35 0.56
36 0.55
37 0.47
38 0.38
39 0.3
40 0.24
41 0.18
42 0.14
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.1
61 0.13
62 0.13
63 0.13
64 0.13
65 0.12
66 0.11
67 0.11
68 0.11
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.13
75 0.14
76 0.14
77 0.14
78 0.14
79 0.14
80 0.15
81 0.18
82 0.14
83 0.17
84 0.17
85 0.17
86 0.19
87 0.19
88 0.19
89 0.17
90 0.17
91 0.16
92 0.17
93 0.16
94 0.15
95 0.17
96 0.17
97 0.17
98 0.19
99 0.18
100 0.22
101 0.23
102 0.21
103 0.22
104 0.24
105 0.23
106 0.21
107 0.2
108 0.15
109 0.15
110 0.14
111 0.11
112 0.08
113 0.08
114 0.09
115 0.08
116 0.09
117 0.08
118 0.09
119 0.15
120 0.15
121 0.18
122 0.23
123 0.23
124 0.28
125 0.33
126 0.35
127 0.35
128 0.41
129 0.42
130 0.39
131 0.39
132 0.33
133 0.29
134 0.25
135 0.2
136 0.15
137 0.13
138 0.1
139 0.09
140 0.09
141 0.09
142 0.11
143 0.14
144 0.12
145 0.12
146 0.13
147 0.14
148 0.15
149 0.15
150 0.13
151 0.11
152 0.13
153 0.13
154 0.15
155 0.16
156 0.16
157 0.17
158 0.18
159 0.19
160 0.18
161 0.17
162 0.15
163 0.17
164 0.18
165 0.23
166 0.31
167 0.37
168 0.4
169 0.42
170 0.46
171 0.48
172 0.48
173 0.46
174 0.41
175 0.33
176 0.34
177 0.33
178 0.28
179 0.25
180 0.25
181 0.24
182 0.24
183 0.24
184 0.21
185 0.21
186 0.21
187 0.17
188 0.17
189 0.16
190 0.13
191 0.11
192 0.11
193 0.1
194 0.12
195 0.12
196 0.16
197 0.18
198 0.22
199 0.28
200 0.34
201 0.35
202 0.35
203 0.41
204 0.41
205 0.45
206 0.45
207 0.47
208 0.49
209 0.57
210 0.62
211 0.63
212 0.61