Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A261Y602

Protein Details
Accession A0A261Y602   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-39KLKGGDPIVKKKKKKTKSEHVSTKSDSBasic
NLS Segment(s)
PositionSequence
14-29LKGGDPIVKKKKKKTK
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MSAYESVTKGALKLKGGDPIVKKKKKKTKSEHVSTKSDSSSSTTTDKKPKKTAAELKFEEAQRLRQEERIRKQAAMSHKDRVADFNRRLEELSEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.3
4 0.35
5 0.35
6 0.43
7 0.53
8 0.58
9 0.62
10 0.66
11 0.75
12 0.79
13 0.84
14 0.84
15 0.84
16 0.86
17 0.9
18 0.91
19 0.86
20 0.82
21 0.74
22 0.67
23 0.56
24 0.45
25 0.35
26 0.28
27 0.23
28 0.2
29 0.21
30 0.21
31 0.24
32 0.34
33 0.39
34 0.41
35 0.46
36 0.49
37 0.5
38 0.55
39 0.61
40 0.58
41 0.61
42 0.56
43 0.54
44 0.52
45 0.47
46 0.42
47 0.33
48 0.31
49 0.25
50 0.28
51 0.26
52 0.27
53 0.35
54 0.4
55 0.47
56 0.51
57 0.5
58 0.47
59 0.48
60 0.48
61 0.49
62 0.47
63 0.44
64 0.41
65 0.41
66 0.43
67 0.42
68 0.42
69 0.4
70 0.41
71 0.42
72 0.44
73 0.44
74 0.43
75 0.43
76 0.39
77 0.37
78 0.32
79 0.34
80 0.29
81 0.27
82 0.26
83 0.28
84 0.26