Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A261XYJ0

Protein Details
Accession A0A261XYJ0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-79MDLPPSPPKKRKREQLHLIQDPSHydrophilic
NLS Segment(s)
PositionSequence
65-68KKRK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MRRKQHLHREINKTSREVIRHRQENNYVLDLLLELYQNQIGDLSDSDVSGSSSVGEMDLPPSPPKKRKREQLHLIQDPSPSELSPSPHQRKPSLSSEPFNNRLAPTPQTTVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.56
4 0.54
5 0.55
6 0.57
7 0.6
8 0.61
9 0.62
10 0.62
11 0.61
12 0.58
13 0.5
14 0.4
15 0.32
16 0.29
17 0.21
18 0.16
19 0.12
20 0.08
21 0.05
22 0.06
23 0.07
24 0.06
25 0.06
26 0.06
27 0.05
28 0.06
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.07
36 0.06
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.05
45 0.05
46 0.06
47 0.08
48 0.12
49 0.16
50 0.25
51 0.34
52 0.43
53 0.51
54 0.6
55 0.69
56 0.77
57 0.81
58 0.84
59 0.85
60 0.81
61 0.75
62 0.66
63 0.57
64 0.47
65 0.4
66 0.3
67 0.2
68 0.16
69 0.15
70 0.19
71 0.24
72 0.34
73 0.39
74 0.42
75 0.47
76 0.48
77 0.52
78 0.53
79 0.54
80 0.54
81 0.52
82 0.53
83 0.58
84 0.62
85 0.61
86 0.57
87 0.51
88 0.42
89 0.42
90 0.42
91 0.37
92 0.34