Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SBA9

Protein Details
Accession Q7SBA9   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-103SAKPVKVGSKKIEKKRRVKKSKIVFPKYGEBasic
NLS Segment(s)
PositionSequence
78-110VKVGSKKIEKKRRVKKSKIVFPKYGEKFSKKRK
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG ncr:NCU06214  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSKRASVIKNNNQKLKKNVFGPVEAARLERISAKLLELAAQPKPIKEVEMETVNEDEVKEATKDDSAMEVDSAKPVKVGSKKIEKKRRVKKSKIVFPKYGEKFSKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.78
4 0.75
5 0.71
6 0.64
7 0.63
8 0.57
9 0.52
10 0.49
11 0.43
12 0.37
13 0.31
14 0.27
15 0.21
16 0.18
17 0.17
18 0.15
19 0.13
20 0.13
21 0.12
22 0.12
23 0.12
24 0.12
25 0.13
26 0.12
27 0.14
28 0.12
29 0.16
30 0.16
31 0.15
32 0.17
33 0.15
34 0.14
35 0.13
36 0.14
37 0.13
38 0.16
39 0.16
40 0.15
41 0.15
42 0.14
43 0.13
44 0.11
45 0.09
46 0.06
47 0.06
48 0.05
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.1
61 0.1
62 0.09
63 0.08
64 0.08
65 0.15
66 0.19
67 0.25
68 0.3
69 0.4
70 0.5
71 0.6
72 0.71
73 0.74
74 0.8
75 0.85
76 0.89
77 0.89
78 0.9
79 0.89
80 0.9
81 0.91
82 0.91
83 0.89
84 0.84
85 0.79
86 0.8
87 0.75
88 0.73
89 0.7
90 0.67